KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0287
Entry
YPA_0287          CDS       T00369                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPA_0287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_0287
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_0287
SSDB
Motif
Pfam: DotU Transp_cyt_pur
Other DBs
NCBI-ProteinID: ABG12256
UniProt: Q1C9Z2
Position
335178..335864
AA seq 228 aa
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDA
GHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRA
VLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILAS
AASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLATLLPEPV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaatcctcacctaaccgaacaccccccagtcggggatattgacgccctgttgcaggac
acctggctacaggtgatcagcctgcgtcaaggggtaacctgtgccgagggcgaagggcag
gcattctggcagcgctgtgtggcggacattgaacgtgtccatcaggcgctgaaagacgcc
ggtcacagcgagcagagttgccagcacatccgatacgcccaatgtgcactgctggatgag
accgtgaaagggcgcggtgtacaggatgatgcctacttcgtgtggtgccattcgccctta
caggcgcattttttcaataccctggatgccggtagccagctttacgagcggatgcgcgcc
gtgttgcgtgagcctgcgccggatcgcgcggtactgacctgttttcaccgggtattgatg
ttgggcttcctcggcgggtacgcctccccggcggcttctgaacgggagcaactgatcgat
caactgagcgtgcaggtaccggcgttcagtgtcgcgccatcacgtgggatcctggcaagc
gccgcctcccgcaaccggttggggatctggttgcgttactggccggtacggctcgggctg
gctgcgctgatggtcgcgctgttgtggtggggccttgatcactggctgtccggtctgtta
gccaccttactgccggagccggtgtaa

DBGET integrated database retrieval system