KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0502Help
Entry
YPA_0502          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ypa03009]
    YPA_0502
Enzymes [BR:ypa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     YPA_0502
Ribosome biogenesis [BR:ypa03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YPA_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: ABG12470
UniProt: Q1CAQ2
Position
585475..586581
Genome map
AA seq 368 aa AA seqDB search
MNNKIALYCRSGFEKECAAEITEKAAQLEIFGFARVKENSGYVLFECYQLEDADRLIREI
PFREFIFARQMMVVGELLKDLPPEDRVSPIVGMLVGVIEKAGELRVEVADTNESKELLKF
CRKLTVPLRSALREQKILSARENAHRPVVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLK
FPSDAPSRSTLKLEEAFHVFIPADEWEERLASGMHAVDLGACPGGWTYQLVQRSMMIQAV
DNGLMAQSLMDTGQVTHHRADGFKYEPTRSNIYWLVCDMVEKPTKVTQLITKWLVNGWCR
EAIFNLKLPMKKRYEEVVQNLAMMDEQLKENGINADIHAKQLYHDREEVTVHVRRIWSGA
PGRRDERY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaattgctttatattgccgctccggctttgagaaagagtgtgcggcagaa
ataacagagaaggctgcacagctcgaaatctttggttttgcacgggtaaaagaaaacagt
ggctatgtattgtttgaatgctaccagttagaggatgcggatcgactcatccgtgaaata
ccgttccgcgagtttattttcgcccgccaaatgatggtggtgggggagttattgaaagac
ttacccccagaagaccgtgtgtcaccgatcgtgggaatgttggttggcgttattgaaaaa
gctggcgagttacgtgttgaggtggccgacaccaatgaaagcaaagagttactcaaattt
tgccgtaagctgacggtacctttgcgtagtgctttgcgtgaacagaaaattctgtccgct
cgtgagaatgcacatcggccagtggtgcatgtgttctttattgcgccgggttgttgttat
gttggttattcttacagcaataataactctccattctatatggggatccctcgacttaaa
ttcccctccgatgcaccaagtcgctcaaccttaaaactggaagaggcattccatgtattt
atccccgcggatgaatgggaggagcgtttagccagtggtatgcatgctgtcgatttaggc
gcttgtcccggtggctggacttatcaattagttcaacgcagcatgatgatacaagcggtt
gataatggtttgatggcacaaagcctgatggatacggggcaggtcacacatcaccgtgct
gatggttttaagtatgagcctacacgcagcaatatttattggttagtgtgtgacatggtg
gaaaaaccaacaaaagtcacgcagcttatcaccaaatggctagtcaatggttggtgccgt
gaagcgatcttcaacctgaaattaccaatgaaaaagcgttatgaagaagttgtacaaaat
ttagcaatgatggatgagcagttgaaagaaaacggtattaatgctgatatccatgccaaa
cagctctaccatgatcgcgaagaagttacggtgcatgtccgtcgtatctggtcgggtgca
ccgggccgccgtgatgagcgttattag

DBGET integrated database retrieval system