KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0512Help
Entry
YPA_0512          CDS       T00369                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypa03016]
    YPA_0512
Enzymes [BR:ypa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     YPA_0512
Transfer RNA biogenesis [BR:ypa03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    YPA_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABG12480
UniProt: A0A0E1NQY7
Position
594586..595359
Genome map
AA seq 257 aa AA seqDB search
MLEIIYQDEHIVAVNKPAGWLVHRSWLDRNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLEGGTVDYAMAEELDKIADKFAKSDK
APQPSVSHYEALAQVEVPLAIGRYETARYSLVALKPETGRKHQLRRHMAHIRHPIIGDST
HGDLRQNRGVAQHFGCSRLMLHASHLHLNHPVTGEALTLTARWDEPWQGLMSQFGWSGIA
PHLERVEFPLTASQDNE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattatctatcaagatgaacacattgttgcggtgaataagcctgccggttgg
ttagtgcatcgtagttggttggaccgcaatgaaacggtatttgttatgcaaacggtacgt
gatcagattggtcagcatgtgtataccgttcatcgccttgatcgcccgacatcaggcgta
ttgctcatggcattgtccagtgatgtggctcgtatgttgtcgttacaatttgagcaacac
cagattcagaaaacgtatcatgcggtggtgcgcggatatgtattggaaggtggcaccgtt
gattacgcgatggccgaagagctggataaaatagcggataagtttgctaagtctgataag
gctccacagccttctgtcagccattatgaagcattagcgcaagtggaagttcctttggcg
attggccgctatgaaactgctcgctatagcttggtggcattgaaaccggaaacgggtcgt
aagcaccagttgcgtcggcatatggctcatatccgtcaccccattattggtgacagtaca
catggtgatttacgtcagaacagaggtgtcgctcagcattttggttgttcacggttgatg
ctgcatgccagccatttacacctcaatcaccctgtgaccggtgaagcgctgacgcttacc
gctcgttgggatgaaccctggcaagggttgatgtcacaatttggctggtcgggtattgcc
cctcatcttgaaagggttgagtttccgctgactgccagtcaggataatgaataa

DBGET integrated database retrieval system