KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0816Help
Entry
YPA_0816          CDS       T00369                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00450  Selenocompound metabolism
ypa00970  Aminoacyl-tRNA biosynthesis
ypa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YPA_0816
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPA_0816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypa01007]
    YPA_0816
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypa03016]
    YPA_0816
Enzymes [BR:ypa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     YPA_0816
Amino acid related enzymes [BR:ypa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YPA_0816
Transfer RNA biogenesis [BR:ypa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YPA_0816
 Prokaryotic type
   Other AARSs
    YPA_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABG12784
UniProt: Q1C9T8
Position
complement(941070..943097)
Genome map
AA seq 675 aa AA seqDB search
MAQVAKKILVTCALPYANGSIHLGHMLEHIQADIWVRFQRMRGNQVHFICADDAHGTPIM
LKAQQMGIEPEQMIAEMSQEHQQDFAGFAISYDNYHSTHSDENRELSSLIYGRLKANGYI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKAPEQYGDNCEVCGATYSPTELIDPKSAVSG
ATPVMRESEHFFFDLPAFSDMLQAWTRSGALQEQVANKMQEWFDSGLQQWDITRDAPYFG
FEVPDAPGKYFYVWLDAPIGYMGAFKNLCDKRGDLDFDEFWGKDAKTDLYHFIGKDIVYF
HSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKAGTYLKYLDADCLRYYYA
AKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFAGQLADQLADPVLYKT
FTDAATSIADAYNNRESGKAIREIMALADVANRYVDEQAPWVVAKQEGRDADLHAICSMG
INLFRVLMTYLKPVLPSLTERTEAFLNTELTWDSIEQPLLGHSITAFKALFNRIDLDKVN
EMVASSKEDMAPATRVTGPLADDPIQETISFDDFAKVDMRIALIQQAEFVEGSDKLLKLT
LELGGETRQVFSGIRSAYPDPKALEGRMTVMVANLAPRKMRFGVSEGMVMAAGPGGSDIF
LLSPDSGAQPGMQVK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagtcgcgaaaaaaatattggtgacgtgcgcgctaccatacgctaacggttct
attcatctcggccacatgctcgagcatatccaggcagacatctgggtccgtttccagcga
atgcgcggcaaccaggttcattttatctgtgcagatgatgcccacgggactcctatcatg
ctgaaagctcagcaaatgggtattgaaccagagcagatgattgccgaaatgagccaggag
caccaacaggatttcgccggttttgctatcagttatgataactatcactccacccacagt
gatgaaaaccgtgaactgtcgagcctgatctatggccgtctgaaagccaacggttatata
aagaaccgtactatttctcagctctatgatcctgagaaaggcatgtttctgcccgatcgt
ttcgtgaaaggcacttgcccaaaatgcaaagccccggaacagtacggcgataattgtgaa
gtctgtggcgcaacctacagcccaactgaacttatcgaccccaaatccgccgtttctggt
gcgacaccagtgatgcgtgaatctgaacacttcttcttcgatttaccggctttcagtgac
atgttgcaagcctggacacgctcaggtgcgctgcaagaacaagtcgcaaacaaaatgcag
gaatggtttgattccggcctgcaacagtgggatatcacgcgtgatgccccttatttcggt
ttcgaagtaccggatgcaccgggtaaatatttttacgtctggttagatgccccaatcggt
tacatgggggcgtttaaaaacctatgtgataaacgtggtgacctggattttgatgaattc
tggggtaaagacgccaaaactgacctctatcacttcatcggtaaagatattgtttacttc
cacagtctgttctggccagccatgttggaaggcagtaacttccgcaagccgacaaacctg
tttgtccatggctatgtcacggtaaacggcgcgaaaatgtctaaatctcgcggtacgttt
attaaggcggggacttacctgaaatatctggatgcggattgcctgcgttactactacgcg
gcgaaactctcttcgcgtattgatgatatcgatttaaatctggaagatttcgtccaacgc
gttaacgccgatatcgttaataaagtggtgaatctggcctcacgtaatgctggttttatc
aataaacgctttgcaggccagttagctgaccaattggctgacccggtgttgtataaaaca
ttcaccgatgccgcaaccagtattgctgatgcttataacaaccgtgagtcaggtaaagcc
attcgtgaaattatggcgctagctgatgtggctaatcgctatgttgatgaacaggctcca
tgggtggtcgctaaacaagaaggccgcgatgccgatctacacgctatctgctcgatgggg
atcaacctattccgtgtcctgatgacctatctgaaaccggtattaccctctctgacagag
cgtaccgaggccttcctcaataccgagctaacttgggatagcattgaacaacctctgctg
ggccactctatcaccgctttcaaggcactgtttaatcgtattgatttagacaaagtaaac
gaaatggtcgcctcgtctaaagaagatatggcacctgcaaccagggttacaggcccgtta
gccgatgatccaattcaggaaaccatcagttttgatgactttgccaaagttgatatgcga
attgcgttgattcaacaagccgaatttgttgaaggctcagataagttattaaaactaaca
cttgaacttggaggggagacccgccaggtattctcgggtatccgttcagcttaccctgac
ccaaaagccttggaaggccgcatgaccgtgatggtcgctaaccttgccccgagaaaaatg
cgctttggggtttcagaaggcatggtgatggccgcaggccccggaggtagcgatatcttc
ctgcttagccctgacagtggtgcgcagccaggcatgcaagtgaagtga

DBGET integrated database retrieval system