KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2120Help
Entry
YPA_2120          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPA_2120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_2120
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Collagen Phage_base_V
Motif
Other DBs
NCBI-ProteinID: ABG14085
UniProt: A0A0H2Y8J3
Position
complement(2372745..2375591)
Genome map
AA seq 948 aa AA seqDB search
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDL
KSLIGKEMTIEMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFY
LANLTSDFKIYQNKNVVDIIEEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLM
EEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYLSDEPKAGEEYITQFQTQET
LTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGEHLSRVRIEE
RGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFS
CESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWD
LPANATQSGMVSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADS
VLNVGANRSEVVGANYNQDVLGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNV
GGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAGGELILSGDIVKIVGKSKVI
IQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLPIVVPPVTSP
PDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPRNHGTAGNHGTARNNGT
ARDNGTAGNHGTAGNNGTARDNGTARDNGTARNNGTAGNNGTAGNNGTAGNNGTAGNNGT
AGNHGTARDNGTARDNGTAGNNGTARNNGTAGNNGTAGNNGTAGNNGTAGNNGTARNNGT
AGNNGTARNNGTAGNNGTARNNGTARNNGTAGTDANTARDADATALIL
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggacaataaatttgagcagcccggctatgccttatctattgggtgagcctgcg
ctggtactgtctaagttggaaggcgaggaagccttttcgactttatattcttatactatt
acggcaaagacaccggctaacccattaattccttggcaagcggcttcaaatgtcgatctc
aaatccttaattggtaaagagatgacgattgaaatggaactggacggcaacggcctgggt
gatgtgagaagtgtaggtaaaggcacgcgtgaaattacggggctggttgagagagccaga
tacattggtcgagatgccaatcaggccatatttgagatcactattaagccttggttctac
ctggctaatttaacctctgactttaaaatttatcaaaataaaaatgtcgttgatattata
gaggaagtgttctcagactataattttccgtttgagaaacggttggctacaacctatccg
atattagattttcaggttcagtacggtgaaaccgactttaatttccttcagcgtttgatg
gaagagtggggtatttactggttctttgagcatcaggatcataaacaaaaattaattctt
gtggatcatgtcggtgcgcataaacgctcgttcagtaccgcctaccatgccattgagtac
ttgtcggatgagcctaaagcgggcgaagagtacatcacacaattccagactcaggaaacc
ttgacgagtgggacctgggtcaccaacgattatgacttcacgaaatcccgtgccgatatt
ctggcaatggacagtaaaccgcgtaaaaccagctttaacgatctcgagatttatcactgg
ccaggggattatgatcagccagatattggtgagcacctttcacgcgtgcgtatcgaagaa
cgtggtgctctgggttcgcgggcggtcggttctggtcaactgcgcgggatagtttgtggt
gctaacttcgagctgaaagggttccccgttgataaagcgaatcgggaatacatgattatc
tccagccgtttgacggtggctgaagttgatcaactgtctggcggtgaggatgcgtttagt
tgcgagagttctttcacggttcagccgacgaccaaaatctatcgtcacccacaggtgaca
ccaaaaccgaaaaccaatgggccgcaaaacgccattattgtggggccaccgggtgaagag
atttggaccgatgaatatggccgcgtaaaagtgcgtttcgtttgggatcgctatggcaca
aacagcgagtcagactcttgctggctacgtgttagccaggcttgggcagggaacagcttt
ggtgggatctatattccacgcattggtcaggaagtcattgttgactgtattaacggcgat
cctgaccggccaatggtgatgggcagcctttataataacgtgacgcgtcccccttgggac
ctgcctgccaatgcgacgcaaagtggcatggtcagtcgtaccgttggcggcgggttaacc
aactataacggcgttcgttttgaagataaatcggggctggagcagtactgggaacaggcc
gagcgcgatatgtcgcgtttgactaaaaataatgaaacgcaaattatcggtgccgattct
gtcctgaatgtaggggccaaccgaagtgaagttgtcggggccaattataaccaagatgtt
cttggcacatcaatgttagccatcggtgcagcctctatgctacaggtgggattggcgcgt
agcgttgtggttggcggagcacattcactgaatgtggttttggcgaatgccaccaatgtg
ggtggcgctaacatgaccaacgtaggggggtttaatggccttgcggtggggggagcccat
cagacagctgtaggcggtgctgcgacactggctgccggcggccctattgctattggggcg
ggtggtgagcttatcctcagtggggatatcgtaaaaattgttggtaaaagtaaggttatt
attcagggcggtgaagttcacattaactctgatgattgttgtggtcgtaaaacgggcaat
ggcggcggggcattcggtgcctttgcgagcctggcaggtttattgccgctggcgggtgct
attgccttaccgctaccgttacccttgttgccaatagtggtgccaccagtgacatcgcca
ccggatccaacagtgccaccggatccgacattgccaccggatccgacattgccaccagat
ccaacgttgccaccagatccaacgttaccgccggaaaccacggcaccgccggaaaccacg
gcaccgccgcgaaaccacggcaccgccggaaaccacggcaccgccagaaacaacggcacc
gccagagacaacggcaccgccggaaaccacggcaccgccggaaacaacggcaccgccaga
gacaacggcaccgccagagacaacggcaccgccagaaacaacggcaccgccggaaacaac
ggcaccgccggaaacaacggcaccgccggaaacaacggcaccgccggaaacaacggcacc
gccggaaaccacggcaccgccagagacaacggcaccgccagagacaacggcaccgccgga
aacaacggcaccgccagaaacaacggcaccgccggaaacaacggcaccgccggaaacaac
ggcaccgccggaaacaacggcaccgccggaaacaacggcaccgccagaaacaacggcacc
gccggaaacaacggcaccgccagaaacaacggcaccgccggaaacaacggcaccgccaga
aacaacggcaccgccagaaacaacggcaccgccggaaccgacgcgaacaccgccagggac
gcagacgccaccgccttgattttatag

DBGET integrated database retrieval system