KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2130
Entry
YPA_2130          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_2130
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_2130
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABG14095
UniProt: A0A0E1NM55
Position
complement(2387556..2388080)
AA seq 174 aa
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADR
KLLDIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLS
QLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atggttagcaaaagtaattctcaaaagtttatcgctcgaaaccgagcgccacgcgtgcag
attgaatacgatgtggaaatatacggtagtgaaaagaaggttgaattacctttcgttatg
ggggtattagcagatttatccggtaaacctcttgagcctttaccttcagtcgctgacaga
aaactgttagatatcgatattgataatttcgatgagcgcatgaaagcaatgaaaccacgt
gttgcattcgccgtgctgaatacattgactggggaaggccagttaatggtcgatattacg
tttgagagtatggatgatttctctcctgacgctatcgcgaaaaaagttgattcattgtct
caattattagatgcccgaactcaacttgccaacttgcagacttatatggatggtaaggct
ggtgctgaggaattagttatgaaattgctgaaagacaaatcattactgacaacgcttgca
tccgcaccgaaagcaaaacaatccgctgttgatactccacagtaa

DBGET integrated database retrieval system