KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2140
Entry
YPA_2140          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_2140
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_2140
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABG14105
UniProt: A0A0E1NX28
Position
2401027..2402208
AA seq 393 aa
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEP
NNWTDIERKCLELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQ
LFDEGEFEPLMRGNAFAELEDIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGAL
DEGTLEAVKQEWQNRSDHTILSLQHAYALLQGLATRLNNSLGEDTPDFVRMTSVLRHFDA
AITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTVAETQMAIPIEAPQQRQAVVT
PSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFTAMEPSSPVIA
LLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagtgaacagagtatcgctgaacgtgccggttattatcaaagcatgatgcagcccatt
ccaggtgactttccttgtggcaaaaatctggaatatgacccggcatttattatgctacag
acaaaattgcaacctaagcaggccgctgaatacggcaattttgttgaggtcgctgaaccc
aataactggacagatatcgagcgtaaatgccttgaactcctgaataattctcgggatatt
cggctgtttattattctgatgcgctgccggatgcgtcaggtcggtgtgggcgcgttgcaa
gaagggctggaagccatactttggtgcctcgacacttggcctgatcagctacatcctcag
ttgtttgatgaaggggaatttgaacctttaatgcgcggtaatgcttttgctgaactggaa
gatattgatggttttatcgccgacttccgtaatcagcagttacccaaagccgctggcgtg
caactttccatcaaagagtttgaaaaagcacactccgttcctcgagaagaaggggcattg
gacgaagggactctggaagccgttaagcaagagtggcagaaccgatcagatcacaccatt
ctctcactccagcacgcttatgccttgttgcaaggattagccacgcgcctcaacaactcc
ctcggtgaagacacacctgattttgtcagaatgacctcagtgttacgccactttgatgcc
gcgataaccccgatagcgcctatcgtggtgccgatcccagaagttgtcgagctctatcca
gtcgccacagcgatgctagcaagcacagaaatgccagtgaccgccgaggtacagacggtt
gcagagacacaaatggccatacccattgaagctccccaacagcgtcaagcggtggtaacc
ccatccccacagttgcagccgttacagttgcaatcggcacagttgcaacctgtaccgata
cagtcacagccggtgcctgtccagcagcaagggatccaaaacagggctgatgcattagcc
cggcttatagaggtgcgagagtggtttaccgccatggaaccgagtagcccggtcattgcc
ttactggctttttcagaaaaaactatcggcaaaagcttcggcgaattgctgcagttcatt
cctcaggaactgatttcgaaactcaatgaaggacaggagtaa

DBGET integrated database retrieval system