KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2323Help
Entry
YPA_2323          CDS       T00369                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00230  Purine metabolism
ypa00240  Pyrimidine metabolism
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
Module
ypa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ypa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ypa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ypa_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YPA_2323
   00240 Pyrimidine metabolism
    YPA_2323
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ypa04131]
    YPA_2323
Enzymes [BR:ypa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     YPA_2323
Membrane trafficking [BR:ypa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    YPA_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABG14288
UniProt: Q1C5I4
Position
complement(2603049..2603477)
Genome map
AA seq 142 aa AA seqDB search
MALERTFSIIKPNAVANNDIGAIYARFERAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF
DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFSDSFTANAVHGSD
AVESAQREIAYFFAADEIFPRS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaacgtactttctcgattatcaaaccaaatgctgttgccaataacgacatc
ggtgccatttatgcgcgttttgaacgtgctggtttcaaaatcatcgccgcaaagatgttg
cacctgaccaaagaacaggccgaaggtttttacgctgagcataaaggccgcccgttcttt
gatggtttggttgaatttatgacctctggccccattatggttcaggttctggaaggcgaa
aatgcggtacagcgccatcgcgatattatgggggcgactaacccagataacgcactagcc
ggtacgctacgtgctgatttttctgacagtttcaccgcgaatgcggtacatggctctgat
gctgttgaatctgctcaacgcgaaatcgcgtatttctttgcggcagatgaaatttttccc
cgtagctaa

DBGET integrated database retrieval system