KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2586Help
Entry
YPA_2586          CDS       T00369                                 

Definition
(GenBank) 5'-nucleotidase/2' 3'-cyclic phosphodiesterase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00230  Purine metabolism
ypa00240  Pyrimidine metabolism
ypa00760  Nicotinate and nicotinamide metabolism
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YPA_2586
   00240 Pyrimidine metabolism
    YPA_2586
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YPA_2586
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     YPA_2586
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     YPA_2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Lipase_GDSL_lke
Motif
Other DBs
NCBI-ProteinID: ABG14549
UniProt: A0A0H2YAK6
Position
complement(2879410..2880378)
Genome map
AA seq 322 aa AA seqDB search
MPGKKIKLTTSPYCTPMIIMVTSGKTSKVSMVLLHRKPWWMKFVNKWPQKEEAYCYSRAV
IINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLSVLRQQEKWAKFPLLSANIY
QKGTQQRLFKPYALFDKQGIKIAVLGLTTDDTPKVSSPENVVDIEFRVPAVEAKHVVEQL
RKTEKPDIIIAATHMGHYDDGKHGSNAPGDVEMARSLPAGYLDMIVGGHSQNPVCMASEN
HRQVDYVPGSPCVPDRQNGTWIVQAHEWGKYVGRADFTFRNGELTLVNYQLIPINLKKKL
RKLMALASTSFIPKRLLRTPQC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgggaaaaagataaaacttacgacatcaccatattgcacaccaatgatcatcatg
gtcacttctggcaaaacgagcaaggtgagtatggtcttgctgcacagaaaaccgtggtgg
atgaaattcgtaaacaagtggccgcaaaaggaggaagcttattgctactctcgggcggtg
attattaataccggtgtccctgaatccgatttacaggatgccgaacccgattttcgcggc
atgaatttggtcggttatgatgcgatggctattggtaaccacgaatttgataatcccttg
agtgtgctgcgtcaacaagagaagtgggcgaagttcccgctactgtccgccaatatctat
cagaaaggtacgcaacagcggttattcaagccttatgctttgtttgataagcaaggtata
aaaattgccgttcttggtttgaccacagatgacaccccgaaggtgagtagccccgagaat
gtcgtcgatatagaatttcgggttcctgccgttgaagcgaaacacgtggttgagcaactg
cggaaaactgaaaaaccagacatcattattgctgccacacatatgggacattacgatgat
ggtaaacacggatccaacgccccaggtgatgtggaaatggcgcgtagcttaccggctggc
tatctggatatgattgtgggcgggcactcacagaatccggtctgtatggccagtgagaat
cataggcaagttgattatgttccaggtagtccatgcgtacccgatcggcagaatggtacc
tggatcgtgcaggcccatgagtggggtaaatatgtcgggcgggctgacttcacattccgt
aatggcgaattaacattggtcaactaccagttaatcccgatcaatttaaagaaaaaattg
agaaagctgatggcactcgcgagcacgtcttttatacccaagagattgctcaggacccca
caatgctga

DBGET integrated database retrieval system