KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2920Help
Entry
YPA_2920          CDS       T00369                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00010  Glycolysis / Gluconeogenesis
ypa00020  Citrate cycle (TCA cycle)
ypa00620  Pyruvate metabolism
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
ypa01120  Microbial metabolism in diverse environments
ypa01130  Biosynthesis of antibiotics
ypa01200  Carbon metabolism
Module
ypa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPA_2920
   00020 Citrate cycle (TCA cycle)
    YPA_2920
   00620 Pyruvate metabolism
    YPA_2920
Enzymes [BR:ypa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YPA_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA Ifi-6-16
Motif
Other DBs
NCBI-ProteinID: ABG14882
UniProt: A0A0E1NYB7
Position
complement(3251207..3252736)
Genome map
AA seq 509 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQVAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKISTGDKVKTGSLIMVFEVEG
AAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDI
QAYVKDAVKRAEAAPAAAGGGLPGILPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV
MIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLMKAAAKALEEFPRFNSSI
SEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSRELSVISKKARDGKLTAS
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLSLSF
DHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggtagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtatcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcgccagccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgcc
gagaatgacgcttacgtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggt
gtgaacctggcgaaggtgaaagggacaggccgtaagggccgtatcctgcgcgaagacatt
caagcttacgtgaaagatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggc
ggcctgccgggcatattgccttggccaaaagttgatttcagtaaatttggtgaaatcgaa
gaagtcgaattgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtc
atgatcccacatgtgacgcaattcgatgaagcggatatcactgaagttgaagccttccgt
aagcaacagaacatcgaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtg
ttcctgatgaaggccgccgctaaagcactggaagaattcccacgctttaacagctccatt
tccgaagatggtcagaaactgacgctgaagaaatacatcaatatcggtgtggcggttgat
acgcctaacggcttggtagttccagtattccgtgacgtcaacaaaaagggtattgtcgag
ttgtctcgtgagctatctgtcatctccaagaaagcacgtgatggcaagctgacagcatct
gacatgcaaggcggctgtttcactatctccagtctgggcggtatcggcggtacggcattt
acgccaatcgtcaatgcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaa
cctgtctggaatggtaaagagtttgctccacgcctgatgttaccgctgtctctgtccttc
gatcaccgtgtgattgatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccatt
atggcggatattcgccgtctggtgatgtaa

DBGET integrated database retrieval system