KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3238Help
Entry
YPA_3238          CDS       T00369                                 

Definition
(GenBank) LSU ribosomal protein L17P
  KO
K02879  large subunit ribosomal protein L17
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YPA_3238
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypa03011]
    YPA_3238
Ribosome [BR:ypa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YPA_3238
  Bacteria
    YPA_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L17
Motif
Other DBs
NCBI-ProteinID: ABG15200
UniProt: Q1C2X2
Position
complement(3590865..3591254)
Genome map
AA seq 129 aa AA seqDB search
MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDNV
ANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRAGDNAPMAYIELVDRAA
SQAEVVAAE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatcgtaagagtggtcgtcaactgaaccgtaacagcagccatcgccaggctatg
ttccgtaacatggccggctctttggttcgtcatgagatcatcaagacgaccctgccgaaa
gcgaaagagctgcgtcgcgttgttgagccgctgattactcttgccaagaccgacaacgta
gctaatcgtcgtctggcattcgcccgcactcgtgataacgagatcgtggcaaaactgttt
aacgagctaggcccgcgtttcgcgagccgcgccggtggttacactcgcattcttaagtgt
ggcttccgtgcaggcgacaacgcaccgatggcttacatcgagttagttgatcgtgctgca
tcgcaagcagaagtagttgctgcagagtaa

DBGET integrated database retrieval system