KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3407
Entry
YPA_3407          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_3407
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_3407
SSDB
Motif
Pfam: ImpA_N DUF3701
Other DBs
NCBI-ProteinID: ABG15369
UniProt: A0A0E1NUA0
Position
3802913..3803695
AA seq 260 aa
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDL
QTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQL
RQHDFTRDDLRLVYRAERALQLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAK
AQQTAAPLKMPPMVYLSVPEAEPVRTAAAAPEPAANIEVRSPPRRLNGGRCCGALVPVSC
VVYWWRLRFTLPSSNRCNSK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagtgacaccccgcaacatatcatcattaaaaccggcactgacccacggaaccggccg
gaatttaacgccattcgtgaagagatcaacaaaatcaaccacccggcacggccagaggtc
aactggggtttgattgaatcactggcgctgaccctgttccgcacccacggcgtggatttg
cagacggcggtgtattacacgctggcccgcacccaaaaaaatggcctggccggtttcacc
gagggctgcgagttgctggccggtatggtagtcggccagtgggatcacctgtggccggaa
cagccgcaggcacgcagtgaaatactggaatggttcaatacccgcgtcagcaatcaactg
cgtcagcatgattttacccgtgacgatctgcggctggtgtaccgcgccgagcgggccttg
cagttgctgtacgataaattgcaacaggttgaattaaaacgggtaccgcgcattgaaaac
ttgctgtacctgatgcagaacaccgccaaaaaactcgaatcggccagtgatgcggcgaag
gctcagcaaaccgcggccccgctgaaaatgccgcctatggtctatctctcggtacccgag
gccgagcctgtccggacggcagcggcagcccctgagcctgcggccaatattgaggtgcgt
tcgcccccccggcgactaaacggggggcggtgctgtggggctttggtgccggtgtcctgt
gtagtttactggtggcgactgcggtttacgttacccagttcaaaccgctgcaacagcaaa
tga

DBGET integrated database retrieval system