KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3408Help
Entry
YPA_3408          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypa02044]
    YPA_3408
Secretion system [BR:ypa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPA_3408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL Nodulin
Motif
Other DBs
NCBI-ProteinID: ABG15370
UniProt: A0A0H2YB02
Position
3803602..3804225
Genome map
AA seq 207 aa AA seqDB search
MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLST
LENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQR
LHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPV
LIKQIDDRWNALLSRYHHLTQQTNSAR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtggggctttggtgccggtgtcctgtgtagtttactggtggcgactgcggtttac
gttacccagttcaaaccgctgcaacagcaaatgacggtgctggccacccaaccggaaagc
gcggcattgctgtggctcaaccgcccggatgtcgccacctatggtgagcaactgagcacc
ctggaaaacctctcgcccctgtttgtgctcaataccgccgaccagtcggtggcgatggct
cgtcaacgctggccgtccgatcccagtcaggtggccgaaagccagcgctgggcgcggttg
gtggaggcgcgtatcggcctggccggtaccgacagcagctatttccagctccagcagcgc
ttgcatgcgctgtctgaaaaattactcgaacaggaacgttctcggggcagtctgaccatc
tcctatctaaaaacagcagtttaccagatgcagaccgagctgaaccgggagataccgctg
gaggagttactgcgccagttggcggtgtccgccgatgaacatcaaccggcctcgccggtc
ttgataaaacaaattgatgaccgctggaatgccttactcagccgttatcaccacttaacg
cagcagacgaactctgcccgttaa

DBGET integrated database retrieval system