KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3835Help
Entry
YPA_3835          CDS       T00369                                 

Definition
(GenBank) ATP-binding region, ATPase-like
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPA_3835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypa01001]
    YPA_3835
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypa02022]
    YPA_3835
Enzymes [BR:ypa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPA_3835
Protein kinases [BR:ypa01001]
 Histidine kinases
  NarL family
   YPA_3835
Two-component system [BR:ypa02022]
 NarL family
  UhpB-UhpA (hexose phosphates uptake)
   YPA_3835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c HATPase_c_2 HATPase_c_3 DUF5110
Motif
Other DBs
NCBI-ProteinID: ABG15797
UniProt: A0A0E1NU19
Position
complement(4320489..4321199)
Genome map
AA seq 236 aa AA seqDB search
MGSGIQRQRELNDQLQIKLNENRELAKALVVSEEHTRHDVARELHDEVGQTVTVIRTQAS
IIKRLTTQQPVLTSAEMIETAALRVYDGVHDVLAKLWPAALNNLPLSAAIAALMRELIPQ
DQSVLGVLNWQVNDHPMDETLKITLYRICQEGVTNAYRHGAASRIEINARQDNQQIYLTI
SDNGKGIDLASITPGYGLRGIQSRVSAFGGNVSLSVDNGTCLNVTLPTVSLSTKGN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttgggatccggcattcaacgacagcgggagttgaacgatcaactacaaataaaattgaac
gaaaaccgtgagttggctaaagcattagtggtttctgaggagcatacacggcacgatgtc
gcgcgtgagttacatgatgaagtggggcaaaccgtaacggttatccgtacccaagccagt
attattaaacgtctgaccacccagcaaccggtactgaccagtgcagagatgatagaaact
gcggcattgcgggtttatgatggtgtccatgacgtattggctaaattatggccagcggca
ttaaataatttgccgctgtcggccgccatcgctgcattgatgcgcgaactcattccgcaa
gaccagtcggtgctcggtgtgcttaactggcaggtcaatgaccatccgatggatgagacg
ttgaaaattacgctttaccgtatatgtcaggagggggtgaccaatgcttatcggcatggt
gccgccagccgaattgaaattaatgcacggcaggataaccaacagatatatctaacgatt
agcgataatggtaaaggtatcgatttagcctcaattactccaggctatgggctacggggt
attcagtcacgggtcagtgcgtttgggggcaatgtgagcctaagcgttgataacggtact
tgcttaaatgtgaccctgcccacagtttctttgtctacaaaaggaaactaa

DBGET integrated database retrieval system