KEGG   Yangia pacifica: CEW88_05605Help
Entry
CEW88_05605       CDS       T05431                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ypac  Yangia pacifica
Pathway
ypac00480  Glutathione metabolism
ypac00590  Arachidonic acid metabolism
ypac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CEW88_05605
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CEW88_05605
Enzymes [BR:ypac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CEW88_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWI83184
UniProt: A0A2U8HBQ0
Position
1:complement(1161009..1161542)
Genome map
AA seq 177 aa AA seqDB search
MRILPLLAVLATAALPALALPGKASEATVFDSIDGGTLDLESWRGGPVLVVNTASRCGFA
PQFDGLQTLYERYRDRGLVVLAVPSNDFRQELGSEAEVKDYCEINFDLDMPMTTITHVTG
HGAHPFYRELAEAKNFAPSWNFNKVLIGPNGEFVAGWGSTTLPLSDPIVSEIEPLLN
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctcccccttcttgcggttctcgccaccgctgccctgcccgccctcgccctg
cccggcaaggcctccgaggccacggttttcgactccatcgacggcggcacgctcgatctg
gaaagctggcgcggcggcccggttcttgtggtcaacaccgcctcgcgttgcggcttcgca
ccgcagttcgacgggctgcagacgctttacgaacgctaccgcgatcgcggactggtggtg
ctggcggtgccgtcgaacgatttcaggcaggagctgggaagcgaagccgaggtgaaggac
tattgcgagatcaacttcgatctcgacatgccgatgaccacgatcacccatgtgaccggg
cacggtgcgcatccgttctaccgggaactggccgaggcgaagaacttcgccccgtcctgg
aatttcaacaaggtgctgatcggaccgaacggcgaattcgtcgccggctggggcagcaca
accctgcccctctccgatccgatcgtctcggaaatcgagcctctgctcaattaa

DBGET integrated database retrieval system