KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_0102
Entry
YPTS_0102         CDS       T00744                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypb03000]
    YPTS_0102
Transcription factors [BR:ypb03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    YPTS_0102
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 HTH_Crp_2 TetR_N HTH_3 DUF3606 HTH_24 TrmB
Other DBs
NCBI-ProteinID: ACC87101
Position
complement(106644..107672)
AA seq 342 aa
MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVEQAVLAVGYSPHALSR
NIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGDCAQQTQQERTFVNLII
TKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPTVHIDNLTAAYEAVNYLH
ELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYIIRGDFSYEAGAQSFAALM
ELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFDDLKLSQFCDPPLTTVAQPR
YQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAPKH
NT seq 1029 nt   +upstreamnt  +downstreamnt
ttggaaaataagaaagaattcacaatgaccacgatgaaagatgttgctgaaatggcaggt
gtatcaacagcaaccgtgtctcgcgcgttgatgaaccctgaaaaggtttcaaccgtgacc
cgacaaaaagtggaacaagccgttttggctgttggttattctcctcatgctttatcccgt
aatattaagcgtaatgaatcacgtacgattctggtgatcgtacccgatatcagtgaccca
ttttttgccgatgtcattcagggcattgaacacgcagccgcccagcaaggctatctgata
ttaattggtgattgcgcacaacaaacccagcaagagcgcacatttgttaatctgattatc
accaaacagatcgatggcatgctgctattaggctctaacctgccttttgatgccagtaaa
gaagagcagcgaaatttacccccgatggtcatggcgaatgagtttgctcctgagttggag
ctgccgaccgtacatatcgataacctgaccgccgcttatgaagccgttaactatttgcat
gagttgggccataaacgcatcgcctgtatcgccgggccagaaagcctgccgctgagccat
tatcggttacaaggttatattcaggcactgcgtcgtaatggtattactgtcgataatgac
tatattatacgcggggatttcagctacgaagcgggggcccaaagctttgcggctcttatg
gagctgccccacccccccactgcaatattttctcacaatgatgtcatggctgtaggggct
atctggcaggcgaagcaattagggttacgtatcccgcaggatgtctcgctggttggcttt
gatgacttgaagctgtcacagttttgtgaccccccattaactaccgtcgcacaaccccgt
taccagattggccagcaagccatgttactcttactggagcaactgcaagggcattcagta
caaagtggctcccgcttgttagataccgaattaatcatcagggaaagtactgctgcgcct
aaacactag

DBGET integrated database retrieval system