KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_0635Help
Entry
YPTS_0635         CDS       T00744                                 

Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YPTS_0635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ypb03019]
    YPTS_0635
   03110 Chaperones and folding catalysts [BR:ypb03110]
    YPTS_0635
   03029 Mitochondrial biogenesis [BR:ypb03029]
    YPTS_0635
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypb04147]
    YPTS_0635
Messenger RNA biogenesis [BR:ypb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     YPTS_0635
Chaperones and folding catalysts [BR:ypb03110]
 Heat shock proteins
  HSP70 / DNAK
   YPTS_0635
Mitochondrial biogenesis [BR:ypb03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    YPTS_0635
  Matrix
   MMC/PAM proteins
    YPTS_0635
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    YPTS_0635
Exosome [BR:ypb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPTS_0635
  Exosomal proteins of breast cancer cells
   YPTS_0635
  Exosomal proteins of colorectal cancer cells
   YPTS_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-ProteinID: ACC87619
UniProt: B2K3M0
Position
707120..709030
Genome map
AA seq 636 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMDGTKARVLENSEGDRTTPSIIAYTQDGETLVGQPAKRQAVT
NPQNTLFAIKRLIGRRFQDEEAQRDKDIMPYKIIAADNGDAWLEVKGQKMAPPQISAEVL
KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL
VEEFKKDQGMDLRTDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADGSGPKHMNIKV
TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIQDVILVGGQTRMPMVQKKVADFFGKE
PRKDVNPDEAVAIGAAVQGGVLSGEVKDVLLLDVTPLSLGIETMGGVMTPLITKNTTIPT
KHSQVFSTAEDNQSAVTIHVLQGERKRAQDNKSLGQFNLDGIQPAPRGMAQIEVTFDIDA
DGILHVSAKDKNTGREQKITIKASSGLNEEEIQKMVRDAEANAEADRKFEELVQTRNQAD
HLIHGTRKQLEEAGDKLPAEDKTAIEEAMKGLEAALKGEDKAEIEAKTQALVQVSGKLLE
MAQQQQAAAGGDAGDTSAKKEDDVVDAEFEEVKDKK
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattattggtatcgacttgggtactaccaactcttgtgtagcaattatggat
ggtactaaagcacgtgtgctggaaaacagcgaaggtgatcgcacaacgccttctatcatc
gcttatacccaagatggtgaaactctggttggtcaaccggctaagcgtcaggctgtcact
aaccctcaaaatacactgtttgccatcaagcgtttgattggccgtcgtttccaagacgaa
gaagcacagcgtgataaagatatcatgccgtacaaaattattgctgcagataatggtgac
gcttggctggaagttaaaggccaaaaaatggcaccgccgcagatctctgctgaagtgctg
aagaaaatgaagaaaacggctgaagattatctgggtgaaccagtaactgaagcggttatt
accgtaccggcttactttaacgatgcacaacgtcaggcaactaaagatgcgggccgtatc
gccggtctggaagtaaaacgtatcatcaacgaaccaaccgcagccgcactggcttacggt
ctggataaagaagtgggtaaccgtactatcgcggtctatgacctcggtggtggtactttc
gatatctcaattatcgaaatcgacgaagttgatggcgaaaagaccttcgaagtattggca
accaacggtgatacccacttgggtggtgaagacttcgatagccgtttgatcaactatctg
gttgaagaattcaagaaagaccagggtatggatctgcgtaccgatccactggcaatgcag
cgtttgaaagaagccgctgaaaaagcaaaaatcgagctgtcttctgcgcagcagaccgat
gttaacctgccgtacatcacggctgatggcagcggtccaaaacacatgaacattaaagtg
acccgcgctaaattggagtcactggtagaagatttggtaaaccgctctattgaaccactg
aaagtggctctgcaagatgctggtttgtctgtttccgacattcaggacgttatcctggtg
ggtggtcagactcgtatgccaatggttcagaagaaagtggctgacttcttcggtaaagaa
ccacgtaaagatgtgaacccagatgaggcggtagccattggtgccgctgtgcagggtggg
gttctgtctggtgaagtgaaagacgttctgttgctggacgttactccactgtcactgggt
atcgaaacgatgggtggtgtgatgactccgcttatcactaaaaacaccactatcccgacc
aagcacagtcaggtgttctctactgctgaagacaaccagtctgcggtaactatccacgtg
ctgcagggtgagcgtaaacgtgctcaggataataaatctctgggtcagttcaatctggat
ggtattcagcctgcacctcgcggcatggcgcaaatcgaagtcaccttcgatatcgacgcc
gacggtattttgcatgtgtctgctaaagacaagaataccggccgtgagcagaagatcacc
attaaggcctcttctggtttgaacgaggaagagattcaaaaaatggtacgtgatgctgaa
gcaaacgcagaagctgaccgtaagtttgaagaactggttcagacccgtaaccaggctgac
catctgatccacgggactcgtaagcagttggaagaagccggtgataaattaccagcagaa
gacaaaaccgctatcgaagaagcaatgaaaggcttggaagctgcacttaaaggtgaagat
aaagctgaaatcgaagcgaaaactcaggctctggtacaggtttccgggaaattgctggaa
atggctcaacagcaacaagctgccgcaggcggtgatgctggcgataccagtgccaagaaa
gaagacgacgttgtagacgccgaattcgaagaagtaaaagacaaaaaataa

DBGET integrated database retrieval system