KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_0664
Entry
YPTS_0664         CDS       T00744                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_0664
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_0664
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACC87648
Position
741984..742544
AA seq 186 aa
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDR
KFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQM
EKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVE
DDDGEK
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagatgcgagctcgcaaaaatttatcggtagaaataatgcacctagagtgcaa
attgaatatgacgtcgaaatttatggttcaaataagaaagtagagttgccttttgtaacc
ggcgtgatggctgatctttctggccacagagcaaagcctcttcccgccgttgaagatcgt
aaattccttactttcgatcaggataatttcgatgcccggatgagagcaattaagcctcgc
cttaaattctacgtagataacaccttgagtgaggataacgaactcctggatatcgaactg
gattttgagtcaatggatgacttttctcccggatcgttagcgcggcgtattcctcaaatg
gaaaaactgcttgaggcacgtacccatctggctgaattgatcacctatatggatggtaaa
accagcgcagaagaggtggttaaacaactgcttgaacaacctgattttttacaaaatctt
gcgaccgatgcacagggaactatttcgaagctcagccaggatgatgatgttttagtggaa
gatgacgatggagaaaaatag

DBGET integrated database retrieval system