KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_0679
Entry
YPTS_0679         CDS       T00744                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTS_0679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_0679
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_0679
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 AAA Rad17 AAA_19
Other DBs
NCBI-ProteinID: ACC87663
Position
761081..764575
AA seq 1164 aa
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFS
WIFRYARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDA
KPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAG
EWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLR
LRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFV
ADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPI
GYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQ
VNDNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYV
TNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQWFMSRWESFTPQGYGQNDRKLF
SYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLA
DAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGK
ASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPS
SPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFS
RLQIDMARQPEPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNR
LASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFEN
SAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPK
GGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIE
LSSTMKDYPLWSKALAQFSCPKNL
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgatacgcagaatgttgattttaatcattgccctagtgctttgttatattgtgtggtgg
atagggccgctgatcgccattggcccctatttccctctggggggggtatgggttcgtaag
atcattattgctctgattttattttgggcactgtggccatttgttgcaattttcttcagt
tggatttttcgttatgcccgtgcgccacttcccaagcgcaagaaaaaaacggttcagctt
gatcgcgtttctgcacgttttcatgatgcgatgctcaccctgcaacatgcggatctttca
agccagaaaacacgctggcagcgctggcgtcaacggcgtaagcgccagtatatcgatgct
aaaccgtggtttctggtcatggggccacccggatgcggtaaaacgtcgatagtttatgag
agtagcgagaagttcctactctcagaacagtatggtttagcgcagaccacggatattgga
ccgacgcaggactgtaattggtggctgacggatcgtgctgtttacatcgatacggcaggg
gaatggatcctgctgcatggtcagagcgaagaagcgggcacggctcggcaaaaattgttc
tctatgatccgcaaatatcgccgttatccgggggttgatgggattgttctttgccttgac
gtcagcgtgcttttgaactcttcggtgacggaacgtaagtcactggctgatacgttgcgc
ctgcggatcctggaagttgcctcgacatttcaggccgatattgcggtgtacttgttcctc
aacaatatcgataagttacctggcggcgaaaccttcctctcgctaatgaacgacgaactt
ctggccggagggcttgggattagcatgacccataatgaaaagggtcagaacaatttcgtt
gccgatgaagaacgttaccgtgaactcctgacacgtgttagccgttatgtgttggaaata
ttgcacgattcgcccaatatggagatgcgccaccaattgctgctgtttacagaaagcctg
ggagcgctacaaaaacccctgtttggcttattcgaacaaatatttccggcgacaccgatt
ggctataccggttgtttgcggcagttctggtttggcagtacccaaaatctgacctcatgg
gaggcgctgtattatccgtcatcgaccagcacctttgaaagccggcctgctgggcagatg
tatttccctgcactgagtcaagcgatcaccgaaaggggggtattacacgccaccggccca
atgcctctgcgaaatcgcctgttaaacatcggtaagtatgtgttcgtggtccttgtgctc
tgcatcttattgttgatgctgagcgcccgctatttttgggaatatgactatattggctat
gcgacagctcggtttgaggaaacccgtcggattgtgcgtgacatcccaatcacgaatcag
gtcaacgataatctggtcgcagcttacgaacagttggggtatatcaacacccattatctg
gaaagttcaccgccactgctgacaccgtacttcgagcaccgtttactgaatcaggcgatg
ttgcaaacctaccatcgtcacctgaataaagtgttctggcctgcggtacaaaactacgtc
accaacgagctgaaaaaggacactcaatctcctgacggtgacaactatgacacgctgaaa
gtttacctgatgctcggacaacctgatcaccgctctcaggaggcattggtgcaatggttt
atgtcgcgctgggaaagttttacgcctcagggatatgggcaaaacgaccgcaaactcttc
agttatcatttgagtgaactgttttctgacaccgcctcagctgccccgaaagttaagctg
aatgatgagctgatccgtgaatcacgcattaaagcgatgaaaacaccgatacacatccgg
gtgattaatcgtattcatgacgccccactgcccgcgaggattgaggatcttagtctggct
gatgccgccggtcctagcgtaacactgatgctgagacgtaaaagccccagtacagtaacg
gatttggcgatcccggctttctacactcgggccagctaccacgatgtggttaacccacaa
cttcaggaagcatcggaagcgatgattaacgaggaagcgtgggtgttgagtgacggtaaa
gcttcggttagtcaggttagtttactggctgctgcgcaaaaactgtccgatgaagcgcgc
aagtattatctgatggagtatgccaaccaatgggatgcattcttcaatgatatcagggtg
cgcccaatcaacggacttgatgatgcggcgctgctggcaaggcaactctcagacccgtca
tccccgttggctaatctggtgcgtttctccacacgtgaaataaccctgaccactgacaac
aatggtaaaggggcgatgtcgtcaggctggttcaatattcaacgtaataagctcacgact
gcccgccgtaacatcattgacgaaatgtcgggtgagcgttctcgttttcgtctaacgcca
gagaaagcggtggaggatcgctttgaactattaagacgtctgggatatgccctgcaaagt
gcgtctaccagcaattctgatccgttgggccgaaccttcgagcagatttataaccagttg
ataacactctcgacttcccttcgggctgggcagattttgccgcaaaataacgatttcagt
cgcttgcaaatcgatatggcccgtcagccagagccggtgcgcagcattatgatggatctg
ctggccgtcggacaaacgcaaagtctgcaacaaagtaaggccaacctcagcaagggcgtc
tcttcaattgcttctgatttatgtagcaacgccgtcagtggccgttatccctttaatcgg
ttggctagcgaagagataggtattggcgatttcaaccgtatgtttggtcgttctggggcg
atgcaaagcttctttgatcagaatctcgcaccgtatgtcgataccaacggcaaccgctgg
aaggtaaaacctgacagtaacggtgtggtgacccctaaaactctgcgttcgtttgaaaac
tcagcacaaatccgcgacaccttctttgatgcctccggcaagatggcgatgtcgatgatc
attcgccctatctcactgactccatcaattttggaagcggttcttgatgtcgatggccag
attattaactacagccatggttctaaccaaccggtaaaagttgattggccaggaccgaaa
ggtggggtgtatatccgcctgacgttcaaaactcaggatggaaatgtggaaaccgttagc
ttcaatggtccgtgggctattttccgcatgtatgacgttagtaaccctaggccactcggg
gtcaatagccgtgaactcatgatggtgatggataacgtgagtggcgtcttcaaaattgag
ttgagttccaccatgaaagattatccgctgtggtcaaaagcattggcacagttctcatgt
cctaagaatctctaa

DBGET integrated database retrieval system