KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_0866Help
Entry
YPTS_0866         CDS       T00744                                 

Definition
(GenBank) quorum-sensing autoinducer 2 (AI-2), LuxS
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00270  Cysteine and methionine metabolism
ypb01100  Metabolic pathways
ypb01230  Biosynthesis of amino acids
ypb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YPTS_0866
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YPTS_0866
Enzymes [BR:ypb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     YPTS_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxS
Motif
Other DBs
NCBI-ProteinID: ACC87850
UniProt: B2K5Y4
Position
978451..978966
Genome map
AA seq 171 aa AA seqDB search
MPLLDSFTVDHTIMKAPAVRVAKTMKTPHGDEITVFDLRFCVPNKEVMPEKGIHTLEHLF
AGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVTDQRKI
PELNEYQCGTYHMHSLEEAQSIAKDILDRDVRINHNEELALPKEKLTELHI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccattattggatagctttaccgtagaccataccattatgaaagcaccggcagtacgt
gtcgctaagacgatgaaaactcctcatggcgacgagataacggtttttgatttacgcttc
tgtgtgccgaataaagaagtgatgccagagaaagggatccatacgctagagcacttattc
gctgggtttatgcgggaccacctcaatggtgatggtgttgaaattattgatatctcgccg
atgggatgtcgcacgggtttctacatgagtctgatagggacacctgacgagcaacgggtt
gctgatgcctggaaagcggcaatggcggacgtgctgaaggtcactgaccagcggaagatc
cctgagctgaatgaatatcagtgcgggacttatcatatgcactcgctggaagaagctcag
agtattgctaaagatattcttgaccgtgatgtgcgtatcaaccacaacgaagagttggca
ctgccgaaagagaaactgactgaattgcatatttag

DBGET integrated database retrieval system