KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_1226Help
Entry
YPTS_1226         CDS       T00744                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00020  Citrate cycle (TCA cycle)
ypb00640  Propanoate metabolism
ypb00660  C5-Branched dibasic acid metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
Module
ypb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPTS_1226
   00640 Propanoate metabolism
    YPTS_1226
   00660 C5-Branched dibasic acid metabolism
    YPTS_1226
Enzymes [BR:ypb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YPTS_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACC88201
UniProt: B2K8F1
Position
1372625..1373791
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagctcca
actggctacgcctgtaccactccgcgtgaagcagaagaagccgcatctaaaattggtgca
ggcccgtgggtggttaaatgtcaggttcatgcgggcggccgcggtaaagcggggggcgta
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggctaggtaaaaaa
ctggtcacttaccaaacagatgccaacggacagccggtgcatcagatcttggttgaagca
gccacggatattgataaagaactgtatctgggggcggttatcgatcgcagctctcgccgt
gtggtctttatggcatccactgaaggtggtgttgaaattgaaaaagtcgccgaagagaca
cctgaactgatccataaaattgcattggatccattgaccggaccacagccttaccaaggg
cgtgagctggcatttaaattgggcttgaccggtaaacaagtcggtcaattcaccaagatc
tttatggggctggcaacactgttcctggaacgtgacctagcgatggtagagattaacccg
ttggtggtcactaagcagggcgatctgatttgtctggatggtaagctcggtgccgatggt
aatgccttgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaagaagatgct
cgcgaagcacatgctgcccagtgggaactgaactatgtggcgttagatggcaacatcggt
tgcatggtaaacggtgccggtttggcgatgggaaccatggacatcgtgaaacttcatggt
ggcgaacccgctaacttccttgatgtgggcggtggtgcaacaaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgacaaagtgaaagcggtttttgttaatatcttcggc
ggtatcgtgcgttgtgacctcattgctgacggcatcattggtgcagttgaagaagtgggc
gttaacgtacccgttgttgttcgtctcgaaggtaataacgcagagctgggtgccaagaaa
ctggcagacagcggtttgaatattattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system