KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_1590
Entry
YPTS_1590         CDS       T00744                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_1590
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_1590
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACC88559
Position
1776014..1776514
AA seq 166 aa
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaattagac
ctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatgggt
gattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aaaaacaattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgtaccg
gacacgctggccggggataacaccgatacagccgtctccctgaccttcaacgacatgaaa
gatttcgagccagaaaacgtggcccgtcaaattccgcaactgcgtgccttgctggccatg
cgcaacctgctgcgagaccttaaatccaatctgctggacaacgccaccttccgccgtgag
ctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcggcc
ctggcgccaaaagagggttaa

DBGET integrated database retrieval system