KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_1613
Entry
YPTS_1613         CDS       T00744                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_1613
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_1613
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACC88582
Position
1807635..1808087
AA seq 150 aa
MPDSSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLP
DMSKILQGLPGSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGL
VRYGTAFMPEGRVLMRHLKQQHYLNQRESF
NT seq 453 nt   +upstreamnt  +downstreamnt
atgccggattcctcctcgccgtcactgtatgagcaattgctgggcaatttcaccggcggg
cttgacctgcatcaggtcagtgacgaaaaccaggtcattctctcggtgctggacaatatg
caacgcattcttaattgtcgggccggaacactcagtcatctgcccgattatggcctgccg
gacatgagtaaaattctgcaggggttgccgggcagcgcgcattcgctgctgaccacgctg
tccgccaccttgctgaaatacgagccgcgtctgaaaagtttgcaggtgattctgttgcca
cagaccacacccggtcatctggaatacgccattgatgcggagctgaaagggctgggactg
gtgcgctatggcacggcgtttatgccggagggcagggtgttgatgcgccaccttaaacaa
caacactacctcaatcagcgggagtcattttga

DBGET integrated database retrieval system