KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_2403Help
Entry
YPTS_2403         CDS       T00744                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00520  Amino sugar and nucleotide sugar metabolism
ypb01100  Metabolic pathways
ypb01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ypb_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPTS_2403
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YPTS_2403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ypb01005]
    YPTS_2403
Enzymes [BR:ypb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     YPTS_2403
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     YPTS_2403
Lipopolysaccharide biosynthesis proteins [BR:ypb01005]
 Unusual sugar
  YPTS_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACC89364
UniProt: B2K5L3
Position
complement(2666857..2668860)
Genome map
AA seq 667 aa AA seqDB search
MKAIVFAYHDIGCVGLNALAEAGYDIQAVFTHTDNPGENRFFSSVARVAADLALPVFAPE
DVNHPLWVERIRELQPDIIFSFYYRNMLSDEILSLAPQGGFNLHGSLLPQYRGRAPINWV
LVNGETETGVTLHQMVKKADAGPIAGQYKVAISDVDTALTLHAKMRDAAQELLRNLLPRM
KEGPLPLTPQKEADASYFGRRTAADGEIHWQKSAFTINNLVRAVTEPYPGAFSYLGQRKL
TIWRSRPLDLVHNKLPGTVLSTAPLTVACGEGALEIITGQGEAGLYVQGDRLAQEMGIVT
DVRLGNKPSNTLKRRTRVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRFLGNP
AFHFVEGDISIHSEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRDC
VKYNKRIVFPSTSEVYGMCDDKEFDEDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGVK
EGLKFTLFRPFNWMGPRLDNLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDI
HDGIEALFRIIENRDGCCDGQIINIGNPTNEASIRELAEMLLTSFENHELRDHFPPFAGF
KDIESSAYYGKGYQDVEYRTPSIKNARRILHWQPEIAMQQTVTETLDFFLRAAVIEKTAA
PKDELNA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattgtatttgcctatcatgatattggttgcgtgggtctaaacgcattagca
gaggcgggttacgatattcaggcggtatttacccatactgataatcctggcgagaatcgc
tttttctcttcggtcgctagagtggcagccgatctggcactgccagtatttgcaccggaa
gatgtcaaccaccctttgtgggttgagcgtattcgtgagttacagccggatatcattttc
tccttctattaccgcaacatgcttagtgatgaaatattgtcattggccccacaaggcgga
tttaacttacacggttcgttattgccccagtatcgtggtcgagccccaattaactgggta
ttggtcaatggggaaacagagacgggtgtgacgcttcatcagatggtaaaaaaagcggat
gcaggtccgattgccggtcagtataaagttgccatcagtgatgttgatacggcattgacg
ttgcatgccaaaatgcgtgatgccgctcaagaattgttgcgtaacttattacctagaatg
aaagagggcccactgccgctgactccgcaaaaagaggcagatgccagttattttggtcgg
cgcacggcggctgatggtgaaattcattggcagaaatctgcatttaccatcaacaattta
gttcgtgcagtgactgagccttaccctggcgcattcagttatctggggcagcgcaaactt
acgatttggcgctcacgtccattagatttagtacataacaaattgccaggcaccgtgtta
tcgacggccccactcactgtggcatgtggcgagggggcgctggagattattacggggcaa
ggtgaggccggtctgtatgtccaaggggatcgtttagcacaagagatgggcattgtaacg
gatgtgcgtttgggtaataagccaagcaatacgttgaaaagacgtacccgtgtgttaatt
ctgggggtaaatggttttattggtaatcatttgactgaacgcttattacaagatgatcgc
tacgaagtatatggtttggatattggctctgacgcgataagtcgcttcttaggtaaccct
gctttccactttgtggaaggggatatcagtattcattcggaatggattgaataccatatt
aaaaaatgcgacgtcatcttgccattagtggctattgcgacacccattgaatacacccgt
aatccgctgcgtgtctttgagctagattttgaagaaaacctgaaaattgtgcgagattgc
gttaagtacaataagcgtattgtcttcccatcgacctctgaagtgtatggtatgtgcgat
gacaaagagtttgatgaggatacttcacggctgattgttggcccaattaataagcaacgc
tggatttactctgtatcaaaacagttattagaccgggttatctgggcttacggcgtgaaa
gaaggtttgaagtttacgctgttccgtccatttaactggatggggccacgtttagataac
cttgatgctgcgcgtatcggtagttcacgtgcgattacacagcttattctgaatttggtc
gaaggctcaccaatcaagctggtcgatggtggtgcccaaaaacgttgttttactgatatc
cacgatggcattgaagcgttattccgtattattgaaaaccgggatggttgctgtgatggt
cagatcattaatattggtaatccaactaacgaagccagtattcgtgaattagccgaaatg
ctgttaacgagcttcgaaaatcatgaattacgtgatcactttccgccatttgcaggtttt
aaagatattgagagcagtgcatattatgggaaaggttatcaggatgttgagtaccgcacg
ccaagtattaagaatgcgcgccgaatattgcactggcagccagaaattgctatgcaacaa
acggtcactgagacgctggactttttcttgcgcgctgccgtaattgagaaaactgcagcc
cctaaagatgagttgaacgcatga

DBGET integrated database retrieval system