KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_2757Help
Entry
YPTS_2757         CDS       T00744                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTS_2757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_2757
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C Colicin_V
Motif
Other DBs
NCBI-ProteinID: ACC89717
Position
complement(3056858..3060685)
Genome map
AA seq 1275 aa AA seqDB search
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLL
ILGFWYGAPRFVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTW
CLVKALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFI
SSRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDAL
FLDTSGKYIDDSKDNQTEWSGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSA
TLRTRLDEVRAVLGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVTFPYNEAKEQ
SDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQK
SDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAV
WLVWAFLVSFQHNEGYLQATGAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLD
VANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVEHQSEVALRKTMHSGQSEEVYA
ALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQ
PADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDEL
LHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLA
EKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADA
PGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDP
FRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFER
FFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKM
ALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKAS
AMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttgaatcgattgttttctggctgggccatgaaacgcatattgctggtcggc
tgctttatattgctggctgcggcgatatggtttctggggcctttcctcggctttggtgag
gcgcggcctctcgaaagttatgaagccagaattatttgcatcctgctggcactgctgctg
atcttaggtttttggtacggcgcaccgcgctttgtcattgccgccgtcgttgcctgtgct
gcggtatgggtgattggcccattcatattagttggtgatgatcatcctctgactgatggg
atccgtcgcggcatcattatcgccatcattgcatttattacacttatttatggtacctgg
tgcttagtcaaagcattggcgaaaaatccagcgttactggataacttcattaagcacaag
aaagcggccaagcctgaagcggaggctgaactttctgaagttaatgcgatgatccgcaat
ggcatgaactatgtgcgccgtattcacagtggtattccggcctggcgacgtttctttatc
tccagccgttggcgcacagaactgccttggttcatggttgtcggtatgaaaggtgcaggg
aaaaccgcccttatcctctcttcaggacaggactttcctttacctgagcagctgaatcgt
attggcaaagaaaacccacccactcaacattgtgaatgtttgttctctaatgacgccctg
tttttagacacttcagggaaatacattgatgacagcaaagataatcagactgagtggagc
gggatattaaaggcactcaaaaaatatcgtccggttaaggcaattaatggtgtcattgtc
gcgatttcggcatccgatatcttgggtaaaagtaaagctgatttactgaatgtgtcggcg
acgctacgcacgcgtttggatgaggtacgtgcggtcttgggcgtccgtttcccggtgtat
gtcacgattacaaaactggatcaattatcgggttttgatgaatatttccgtaatttaacg
gctgaagatcgcgagcaaatttggggggtgactttcccttataacgaggcgaaagagcaa
tcagatatgccacttcagcaacgtatcagccatgagctggcactgcttgaggatcgtatc
agcaataatatgcacgtccgccagcaggaagagtatgccgtggcggacagaaaaggcatg
tatgcactcccccaggatttcaggatgctctcccagagggtaacggaagttttacagaat
gttttcttcgcctcacgctttgacgaaacaaaatttcacacgaccctgagagggatctat
tttgtcagcagttgtcagcctgcggatgttgaactgttaaataacaacacgctgattcaa
aagtggcgtaacgttattaatcataaaaaaccgttatcgccagccgatttatcacaaaaa
agtgataatgaagatcggtttatcagcgatgtggcttacgggaaacaatatttcctcaag
cagttgtttagcgatgtgattaccaaagatgccgacttagtcagctataacctgaaagta
caatccaaataccgttttcagaatctattgggacacgcggcttgtattgggttggcagtt
tggctggtttgggccttcttggtcagcttccagcataacgaggggtatttacaggcgacc
ggtgccaagctgagtcagttagaaagcacggtgatgagttatgccaaaacgtccaatgag
cagatcttacctgcgttattgaacgcgacacagcagttacccgagtacggtacgctggat
gtggctaaccctgagcttgactggcgttatggcttatataccggtagcgcaatctcacaa
ggtgcgaacacgctctatcagtttttcttgcaaaaatatctcttcccaatggttgagcat
cagagtgaggttgcattaagaaaaacgatgcactcaggtcagagcgaagaggtttatgcc
gcgttgaagctttatttgatgctgacgggtgaaggtaaatttgatcgtcaatatatgatt
gagcacgtgacccaagattggcagaaaagtggaaaaattgagccttacgaagagaagagt
attttcgtcggtcatttgaacacgctgtttaccctgaaagactggcggcagtacgggcaa
ccggcagacagtgaactgattaagcaggctcgggcaatattggcggaaaaaacagtgacc
gccagactttgggggcgtattcaatcccgcttattggccgatgcccctgccaatatgacg
ttacgtaaaatggtgggtgagcacgcgacacaggtattcaccctgtcagatgatgaacta
ctgcatgaagggatcccagggctttatacctacgcgggttaccatgaggtggttaaaaaa
aaactgacacctttgctgatgttacttcaagaagaggataggtgggtgatggcgcaatcg
ctgtcatcttctcttgacccattgacgttaagacaagatgttctggtgatgtatttacaa
gggtatgccgcttattggaaacgctttctctccagtgttcgtctgatttctgtcgatgcg
gacagtgcagagtatgctcaagggctgtctctggatattgctttgttaaggacgttagtt
tcagaaaattcaccgctactcaatttagccaggcaggcggtaaaagaaacgacactcgcc
gaaaaagaaaaagccattactgatgagataaacatcagaacgcaagggcaattactcagc
caggctaaaaaattacaagaaacgatcgcgtttcgtgaaaataaactgattaaagagtgg
gttgataatcgttttgaatccctgagagtctttgttaatggggaacagagtgctgatgcc
ccggggggcaataatctttctgttcttcagggaacgcagatgagccgaataatcgggaca
ttaaacgatcaatatacgcgttttgttgtttataacagtgcctttgaatatggcgatatc
cctccgttatcccaggatggggaacgtattgcggtggaatcacaaacgtggccggatccg
tttagaaatattattgcaccgttattaacgggctcatctcagaaatttgaaaataaagtg
attactcacacgtccaaagcgattgatatgggggtgggggaaatttgccggaatacgctg
caagggcgttatccatttgctgaaagtgagcaaattgttagtttgaatgattttgagcgt
ttcttcggtactgacggtacggtggacagttatttcaagaaaaacttggagagtaaagtc
gacacctcctcaataccttggcgttataagggcagcgtaagtagtgaaggtttggcgttc
tttgaacaggcggcaatgatcagaaacgtgctatttaataccaatgacggtaaaaaaatg
gcattagatttttccgtatcagtgcgttatttagcacccactatcacccaacttattatg
aattttgatggtaatactgtgcgttattcccatggtcccgtaacgcctgccttctttaaa
tggccgggtttacgtcaaggcaccattgtcagtttaacggcccaacgccagaaggcatcc
gcgatgcccgatattctttttcgcggaccttgggcactcttgcagtgggctgatcaggcc
gatgaaattcgcgatgaagcgaatggcaaacagacgctgacttatctcatggggaaagat
cgtgtcgagcttgaagtctcaggtttaacgcatggtggtgaaaccattagcgatctgctg
agagatttcaaatgccccagtgtcaatgacatgaatggtatttggtaa

DBGET integrated database retrieval system