KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_2799Help
Entry
YPTS_2799         CDS       T00744                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00010  Glycolysis / Gluconeogenesis
ypb00052  Galactose metabolism
ypb00500  Starch and sucrose metabolism
ypb00520  Amino sugar and nucleotide sugar metabolism
ypb00521  Streptomycin biosynthesis
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
Module
ypb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTS_2799
   00052 Galactose metabolism
    YPTS_2799
   00500 Starch and sucrose metabolism
    YPTS_2799
   00520 Amino sugar and nucleotide sugar metabolism
    YPTS_2799
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YPTS_2799
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YPTS_2799
Enzymes [BR:ypb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YPTS_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C ROK
Motif
Other DBs
NCBI-ProteinID: ACC89757
UniProt: B2K906
Position
complement(3108228..3109199)
Genome map
AA seq 323 aa AA seqDB search
MTTYALVGDVGGTNARLALCAVATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEVINDFTAVSMAIPVLPAQDVLQFG
GTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDARLPEKLAPKDITARALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDFLQDIPVYMIT
HPQPGLLGAGAYLRQKLGYELSS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttatgccctggtgggtgacgttggcggtacgaatgcccggttggcgctttgc
gctgttgcaacgggcgagatattgcaagcaaagacatattcagggttggaatatgaaagt
ttagaggatgtaatcaaacaatatctatcagagcatcaagccaaggtcaccgatgcttgt
atcgcgattgcctgcccgattaccggggattgggtcgcaatgaccaatcatacttgggca
ttttctattgccgccatgcaacagaatctggggctggaccatttggaagtgatcaatgac
ttcaccgcagtctccatggctatccccgtgttacctgcccaagatgttctgcaatttggt
ggcacacagccacagcctggcaaaccggtggcagtgtatggcgcaggtactgggctgggg
gtagcacatttagtgaatgttgatcgccgttggattagtttagcgggagagggcgggcat
gttgatttcgcgcctaatagtgaagaagaagaccagattctggccgtattgcgccaggag
ttggggcatgtttccgctgagcgggtgctatctgggccgggcttagtcaatttatatcgg
gcaattgtgatttctgatgcgcgcctaccagagaaactggcaccgaaagatattaccgca
cgggcgctggcggatagctgtaccgattgtcgccgggcattatcactattttgcgtaatt
atgggccgctttgggggcaatttagcccttaacctcagtacgtttggtggcgtttatatt
gcggggggcatcgtgccgcgctttatggagttctttaaagcctctggttttcgcgctgcg
tttgaagataaaggccgttttaaagatttcttacaagatattccggtgtatatgattact
catccacaacccggtttactgggggctggtgcctatttacgccaaaaattggggtatgag
ttgtcaagctaa

DBGET integrated database retrieval system