KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3381Help
Entry
YPTS_3381         CDS       T00744                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTS_3381
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3381
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ACC90336
Position
complement(3739216..3739707)
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFV
FTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHD
VKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagacgacggcggtgcggacatcaagggttct
gttgatgtgcaaagccgtgaaggcagcattgagatcgtggcacaggaccataacctgtac
atcccaaccgataacaataccggcaaactgaccggtacccgtatccacaccccgttcgtt
ttcaccaaagagatcgatgcgtcgaccccgtacctgtacaaagcggtgaccaccggtcag
acactgaaaaccgccgagttcaaatggtaccgcattgatgacgctggccaggaagttgaa
tatttcaacaccaaactggaaaacgtcaaagtggttaaagttgcgccgaaaatgcacgac
gtgaaagatccggcgaaagagaagcacaaccacctggaactggtggaactgcgctacgaa
aaaatcacctggacctttaaagacggcaacatcattcattccgattcttggaatgagcgc
gccaccgcatag

DBGET integrated database retrieval system