KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3807
Entry
YPTS_3807         CDS       T00744                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTS_3807
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3807
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3807
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C gpW
Other DBs
NCBI-ProteinID: ACC90760
Position
complement(4242979..4245177)
AA seq 732 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGIGDAVGGTAGKRINQA
AEVAKTALNAKAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTAAGL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRST
CANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDA
IAPLINLNKDKG
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggtacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atagccggggggatcggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggctaaaaccgccctgaatgccaaagcaaaagtcctggacggcggcgtcacg
ccgctgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
cttacccgcctggtcaaacagccctccggcctgcaatttaccctgacggcggccggttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcactgcgcaatgacgccaatctggggcagggggcgagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggcattcagcacagcggtaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtgggaccg
ccgggggaagagatttactgcgacgaatacgggcgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgctggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcaccgggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgctcaaaaggatatgagtaccacggtaaaagataaccagacgacgacggtggagaaa
ggtaatcaaaccgtcaccgtggaaaaaggtgacaggacagtcacggtcgcgaccggaaat
gaaaccacagatattacccaagggagcctgaccgagacgatcaaagtgcgtcgcagtacc
tgcgcgaattttattcaggtgaaggctgaaggtgatgcgcctggtacgcaactttatacc
gcgacggaacagataaagttcgtggtgggcaagagcagcattaccttaaatccggactct
attattctgcaattttctggctctacctctattacgctgaatgccgccaatattgacgcc
atcgcgccattgattaacttaaataaagacaagggataa

DBGET integrated database retrieval system