KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3808
Entry
YPTS_3808         CDS       T00744                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3808
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3808
SSDB
Motif
Pfam: VasL ImpA_N DUF3701
Other DBs
NCBI-ProteinID: ACC90761
Position
complement(4245199..4246512)
AA seq 437 aa
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDL
QTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQL
RQHDFTRDDLRLVYRAERALQLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAK
AQQTAAPLKMPPMVYLSVPEAEPVQTAAAAPEPAANIEVRSPPPATKRGAVLWGFGAGVL
CSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLSTLENLSPLFVL
NTADQSVAMARQRWPSDPGQVAESQRWARLVEARIGLAGTDSSYFQLQQRLHALSEKLLE
QERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWN
ALLSRYHHLTQQTNSAR
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagtgacaccccgcaacatatcatcattaaaaccggcactgacccacggaaccggccg
gaatttaacgccattcgtgaagagatcaacaaaatcaaccacccggcacggccagaggtc
aactggggtttgattgagtcactggcgctgaccctgttccgcacccacggcgtggatttg
cagacggcggtgtattacacgctggcccgcacccaaaaaaatggcctggccggtttcacc
gagggctgcgagttgctggccggtatggtggtcggccagtgggatcacctgtggccggaa
cagccgcaggcacgcagtgaaatactggaatggttcaatacccgcgtcagcaatcaactg
cgtcagcatgattttacccgtgacgatctgcggctggtgtaccgcgccgagcgggccttg
cagttgctgtacgataaattgcaacaggttgaattaaaacgggtaccgcgcattgaaaac
ttgctgtacctgatgcagaacaccgccaaaaaactcgaatcggccagtgatgcggcgaag
gctcagcaaaccgcggccccgctgaaaatgccgcctatggtctatctctcggtacccgag
gccgagcctgtccagacggcagcggcagcccctgagcctgcggccaatattgaggtgcgt
tcgccccccccagcgaccaaacggggggcggtgctgtggggctttggtgccggtgtcctg
tgtagtttactggtggcgactgcggtttacgttacccagttcaaaccgctgcaacagcaa
atgacggtgctggccacccaaccggaaagcgcggcattgctgtggctcaaccgcccggat
gtcgccacctatggtgagcaactgagcaccctggaaaacctctcgcccctgtttgtgctc
aataccgccgaccagtcggtggcgatggctcgtcaacgctggccgtccgatcccggtcag
gtggccgaaagccagcgctgggcgcggttggtggaggcgcgtatcggcctggccggtacc
gacagcagctatttccagctccagcagcgcttgcatgcgctgtctgaaaaattactcgaa
caggaacgttctcggggcagtctgaccatctcctatctaaaaacagcagtttaccagatg
cagaccgagctgaaccgggagataccgctggaggagttactgcgccagttggcggtgtcc
gccgatgaacatcaaccggcctcgccggtcttgataaaacaaattgatgaccgctggaat
gccttactcagccgttatcaccacttaacgcagcagacgaactctgcccgttaa

DBGET integrated database retrieval system