KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3810
Entry
YPTS_3810         CDS       T00744                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3810
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3810
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N MafB
Other DBs
NCBI-ProteinID: ACC90763
Position
complement(4250202..4251590)
AA seq 462 aa
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQA
MALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFA
QQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPE
RVIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAI
GFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLARLANADLPLWHQVEQSLTLA
PYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTPFLSSESAAWL
QQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggatatcacgtcacaacatccctggcatgtcttgttacaagcccctttgtcacctgag
cagaccgcacaagccctggccgatgatgacccccaatgggaatatatcgacggccagatg
gtgaaactggggtcattggcccacgccacgctgaatattgatgatattcagcaacaagcc
atggcgctgttatcacagaaaagtaaagacttccggctcgtggtgcatctactgcgcacc
ctacaacacgggggccagccagatgaattaatgctggcgatgtcgttgctgaccgaatac
gtccagctattttggactacggcctggccgcaaaatcctttacacaaacggcgctttgcc
caacaaatcctaaaacgctttgacagcgccagcagcagttttagccaacgagcggacgag
gctcaacgtgagaatgtgcaaggattattggcacatttagcacaggtttggcatagccgt
gagccgggtctggctaaagaggtggatgcattacgcagccgctatgcgcggccaccggag
cgggttatcgaagcagtggcttctgatgaaccgctctcatccaacaccttggcggcggca
atggccgccacccccgttagcccaagcctcgccatagataacacgagcgacagagcctgg
cggcagaccttgctgaaaatggcggatttactgagcgaacagcaacccgatgccgctatc
ggtttccggttacgccgccatgccgtatggggcgcgttaaccgcgccacctatggcgcag
agcgatggccgcaccccgttggccgcagtttctgcggatcgaaccgccgattacttagca
cgtctggctaatgccgatttgcctttgtggcaccaagtggagcagagcctcaccctcgcg
ccttattggctggatgggcatgtgctttcggcacaaatcgccctgcaactgggttatgac
gcggtggcacaggctatccgtgatgaactcagcgtttttttagcccgtattcccgcatta
aaaaccctcttttttacggatatgacgccattcctctcctctgaatctgccgcctggtta
cagcaggatgcgaatcatcagggaagaagtcgcactattgaacaggatgaaatttggcaa
tgctatcaacagcaaggattggaagccgcactacagatgataaaccggcaaccacagcaa
tccgaacctcgggaccgtttttaccatcaattgctcagtgcacagttgttcgaaaaagca
gggttaaccgcattggcgcagcagcactaccacagcttattactggtagggcagcaatta
cagctaagcgaatgggaacctgcgttgatcgctctactgacagaaaaacagcgacaactc
aaaccatga

DBGET integrated database retrieval system