KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3816
Entry
YPTS_3816         CDS       T00744                                 

Definition
(GenBank) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPTS_3816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3816
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3816
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACC90769
Position
complement(4257803..4258348)
AA seq 181 aa
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSD
PDTNPNEKGEAVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQ
FKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEE
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaacaacgccagaggctatctcctgacgtgggcattatgtgtggtgttcctgttgtct
gggtgcagcggtgcatgggaagccactaaaaaggtcggcaaggtggttatggaccctgat
attccggtggggcaggctaccgatcaaccctcaacggtcaggctaacattgctgtccgat
cccgataccaaccctaatgaaaaaggggaagcggtaccgactgagatagtggtggtgtac
ctaagtgaaaactccaagctgctggccgcggattatgatcagctaagcagtgacgcgctg
gagaaaacgctgggtaagaattacatcgatcatcaggaatacaccttactgcccgatcaa
ttcaaggcgctggaccctatcaagctggaagagaaaaacagctatctgggggtgattgct
cactatgccgatgccaaccgcagtgaatggaagaagatcatcaaaataaaagggatcggc
cataactaccaggttttggtccatgtcagatcaaacgatgtcgatctaaggaaagaggaa
gaataa

DBGET integrated database retrieval system