KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_3818Help
Entry
YPTS_3818         CDS       T00744                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypb02044]
    YPTS_3818
Secretion system [BR:ypb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPTS_3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG Ferlin_C
Motif
Other DBs
NCBI-ProteinID: ACC90771
Position
complement(4259790..4260878)
Genome map
AA seq 362 aa AA seqDB search
MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGA
APVATPANEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDS
LAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGS
EVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPDITLHSWQLRKVDIAPSQ
QNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTREQFLSFLPNGANY
ASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSVTIGV
ME
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacagacaggtcaacatgcactgatgtaagtgtggttgaggatgtaagtggg
gttgagaatgtaaatggggttgaggcaagacccgaagggcaggcattggatgtttcacgt
tataacttttttcaattggtcgaattgctcaaccaattggcggtagcgtggcaaggtgcg
gcccctgtggcgaccccagccaatgaagccatccgttttaaatcgaccgccagtttagca
ttcccgaccagagatgtgatcgcactggacacctccgcccgaggtcaatttgagctagag
gtctctttccttggattgcatggcagccaatcgccgctaccaggatattacctcgattcg
ttagcgtgggaggatgcgcagaatgagaaccggttgacggatttcatgaacgtattcaat
caccgcctgttaacgctactgcatcagatttggcgtaaataccgttactacatctgcttt
gacaatggcggtgatgatgcattttcacaacgcatgttctcgctggtggggttaggtagc
gaggtcgtccgcaataaattgcagatcaatcacagcaaaatgctggcttatgcagggctg
ctggccagccccggcagagcacctgaagtaatttgcagccttgtctcacattgcttcaat
ttgccagatatcaccttacacagttggcagctacgcaaggtggatattgccccctcacag
cagaatcgcttggggacgagggtgaaagtccgtggcaagaaatatgatgaaaagtcagtg
cttggcgttaatttctccatcggttcacgggttgcggatcgtagcgggaaattcttgttg
tgcatcaataagctgacgcgagaacagttcttatcctttttacccaacggggctaattac
gcctcgttagtgatgtttgtcgccttcattatgcgcgatcaattcgcgtgggatttacgc
cttgggttggccgagcaacaggtgggcgggatggttctgggaaccgagcaaaatagccta
ttgggctggaccagtatcctcggcgatcccgaacagaaacccagcgtaacgattggtgta
atggaataa

DBGET integrated database retrieval system