KEGG   Yersinia pseudotuberculosis PB1/+: YPTS_3843Help
Entry
YPTS_3843         CDS       T00744                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ypb  Yersinia pseudotuberculosis PB1/+
Pathway
ypb00620  Pyruvate metabolism
ypb00630  Glyoxylate and dicarboxylate metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01200  Carbon metabolism
Module
ypb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YPTS_3843
   00630 Glyoxylate and dicarboxylate metabolism
    YPTS_3843
Enzymes [BR:ypb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YPTS_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACC90796
Position
complement(4294850..4296448)
Genome map
AA seq 532 aa AA seqDB search
MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLATRASWQQTIDQG
ALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGLHLPEKHVKWQD
EAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFNFTEQRFGLSQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHPNRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVRADKELEASNGH
DGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCSGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSNGQTVTKELFRS
MLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacagttagcgggcacagagttagttttcacccagccttttaatgctgctgag
cggcaggttttaccggataaagccatcgagtttctaaccgaattagtggtgaaatttagc
gaatcgcgtaaccaactccttgccacaagggcatcttggcagcaaaccatcgatcagggg
gcgttacccgattttattttggaaactaattccattcgtgatggtgattggaaaatccaa
ggtattcctgctgacttacgcgatcgtagagttgagatcaccgggccagtagagcggaaa
atggtgatcaatgcgcttaatgccaacgtaaaagtttttatggcggatttcgaagattca
ctggcacccagttgggataaagtgattgatggtcaaattaatctgcatgatgcggtgaaa
gggacaatttcctatacgaatgaatcgggcaaggtctatcaattaaaacctaatcccgcg
gtattgattgcacgtgttcgtggcctgcacttaccggaaaaacatgttaaatggcaggac
gaggcgattcccggtggtttattcgatttcgctttgtatttctaccataactatcagcaa
ctgctggcgaagggcagcggcccttatttctatttgccgaagatgcagtcatatcaggaa
gccgcttggtggagcgatgtgttcaattttaccgagcagcgctttggtctatcgcagggc
accattaaggcgacggtattaattgagacattacccgccgttttccaaatggatgaaatt
ctctaccacctgcgccaccacattgttggtctgaattgtgggcgctgggactatatcttt
agctatataaaaacattgaaaaaccaccctaaccgcgtgttaccagatcgccagtcagtc
acgatgaataaaccttttcttagcgcgtattcccgtttgttgatcaagacatgccataaa
cgtggcgctttggcgatggggggaatggccgccttcatcccggataaagacgcagaaaag
aataagttggtgttggataaagttcgtgccgacaaagagttagaagccagtaacggccac
gatggaacttgggtggcgcatccgggcttggcagatacggtgatggacgtttttaacaaa
gtattaggttctcggcctaatcaattagaggttagccgcgaacaggataaacctatcacc
gccgctgagttgctggaaccttgttctggcgagcgcactgaagcagggatgcgggccaat
atcagagtcgcggtgcagtacattgaagcatggatatcgggtaatggttgtgtgccgatt
tatggcttgatggaggatgcggctactgcagagatttcccgcacttctatctggcaatgg
atacatcatcagaaaagcctcagtaatggccagacggtgactaaagagctgttccgcagc
atgttgagtgaagaaattcaggttgtgaagcttgagcttggcgcagagcgttttgatcgc
gggcggtttgaagaagctgcacgcttgatggagcgtattacaacacaagacgagcttatc
gacttcctgacgttgccgggctatgcattgcttgcctga

DBGET integrated database retrieval system