KEGG   Yersinia pseudotuberculosis PB1/+ (serotype 1B): YPTS_4002Help
Entry
YPTS_4002         CDS       T00744                                 

Definition
(GenBank) ketose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ypb  Yersinia pseudotuberculosis PB1/+ (serotype 1B)
Pathway
ypb00010  Glycolysis / Gluconeogenesis
ypb00030  Pentose phosphate pathway
ypb00051  Fructose and mannose metabolism
ypb00680  Methane metabolism
ypb01100  Metabolic pathways
ypb01110  Biosynthesis of secondary metabolites
ypb01120  Microbial metabolism in diverse environments
ypb01130  Biosynthesis of antibiotics
ypb01200  Carbon metabolism
ypb01230  Biosynthesis of amino acids
Module
ypb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTS_4002
   00030 Pentose phosphate pathway
    YPTS_4002
   00051 Fructose and mannose metabolism
    YPTS_4002
  09102 Energy metabolism
   00680 Methane metabolism
    YPTS_4002
Enzymes [BR:ypb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     YPTS_4002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACC90951
Position
complement(4462083..4462943)
Genome map
AA seq 286 aa AA seqDB search
MALISLANGLAHARKNGYALGAFNVLDSHFLRALFAAAKQERSPFIINIAEVHFKYLSLE
SLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVMFDGSTLEYEENVRQTREV
VKMCHAVGVSVEAELGAVGGDEGGALYGEADSNKFTDPAIARDFVDRTGIDALAVAIGNA
HGKYKGEPKLDFARLAAIHQQTGLPLVLHGGSGISDTDFRRAISLGIHKINFYTGMSQAA
LAAVEQKMTHRHAIYDEFAELFLGIEEAITDVVAQQMRIFGSSEQI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatttcccttgcaaatggcctggctcatgccaggaaaaacggttacgcattg
ggtgcctttaacgtgctcgatagccactttttgcgcgccctgtttgccgctgcaaaacag
gaacgatcgccgtttatcatcaatattgctgaagtccattttaagtacctttcgctagaa
tcattggtagaagcagtgaaattcgaagctgcacaccatgatatcccggtggtgcttaat
ctcgaccacggcctgcactttgaagccgtggttcgcgcactcaggctgggttttagttcg
gtaatgtttgatggttccacacttgaatatgaagaaaacgttcgccaaacccgtgaagtt
gtgaagatgtgccatgccgtgggtgtatcggtagaagctgaactgggcgctgttggcggt
gatgaaggcggcgcgctttatggtgaagctgatagcaataaattcactgatcccgccatc
gcccgggactttgttgaccgtaccggtatcgatgccttagcggtcgccatcggcaacgca
cacggcaagtataaaggtgaacccaagctcgacttcgcgcgtctggccgccattcatcag
caaaccggcctacctctggtactgcacggtggctctgggatcagcgataccgatttccgg
cgggctatcagccttggcattcataaaatcaatttttataccggcatgtcgcaggcagcg
ctggctgccgtggaacagaaaatgactcatcgacacgctatttatgacgagttcgccgag
ttgttcctggggatcgaggaggctattactgatgtcgtagcgcaacaaatgcgaattttc
ggcagttcagagcaaatctga

DBGET integrated database retrieval system