KEGG   Yersinia pseudotuberculosis 1: BZ23_108Help
Entry
BZ23_108          CDS       T03679                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
ypc  Yersinia pseudotuberculosis 1
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BZ23_108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJJ72061
UniProt: A0A3G5KER2
Position
complement(130617..130994)
Genome map
AA seq 125 aa AA seqDB search
MIEQPRICVQVQSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDHLGQAFRTVIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgtatttgtgtgcaggtacaaagtatctatgtggaaacgcaatcg
atacccgaagaggagcgtttcgtcttcgcctataccgttactgttcgtaatttagggcgt
tcaaacgtgcaactgcttggccgctattggttaattaccaatagcaatggccgccagact
gaagttcagggagaaggggttatcggcgaacaaccacttatcctgccaggtaatgaattt
caatacaccagcggtgccgttctggaaaccccgctgggtactatggaaggacattatgaa
atgattgatcaccttggacaggccttccgtactgtaattccggtattccgcttagcgatc
ccagccctgatccattaa

DBGET integrated database retrieval system