KEGG   Yersinia pseudotuberculosis 1: BZ23_1788Help
Entry
BZ23_1788         CDS       T03679                                 

Definition
(GenBank) alkaline phosphatase family protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc00730  Thiamine metabolism
ypc00790  Folate biosynthesis
ypc01100  Metabolic pathways
ypc02020  Two-component system
Module
ypc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BZ23_1788
   00790 Folate biosynthesis
    BZ23_1788
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZ23_1788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypc04147]
    BZ23_1788
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ypc00537]
    BZ23_1788
Enzymes [BR:ypc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BZ23_1788
Exosome [BR:ypc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZ23_1788
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ypc00537]
 Enzymes
  BZ23_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AJJ69403
UniProt: A0A3G5KQA6
Position
complement(1997087..1998532)
Genome map
AA seq 481 aa AA seqDB search
MNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQFGGARRLTED
QTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYA
LDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVST
AELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEGRADVTLGGGA
ASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGLFSPGNMPVRW
QGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDK
QDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQ
ALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAL
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgtacctactttatccggcatagcattatcatccggcatagcattatcgact
ctgttactgtccagtgcgctattaacgcctaatgcgattgcggctgctacgggcttatat
gatcgtgctgcgcatggtgatgtgactcaatttggcggcgcacgtcgtttgactgaagac
caaacccaggctctgcgtgactcgttatccaataaaacagtaaaaaatgtcattttgttg
attggagatgggatgggcgattctgaaatcacgtctgcccgtaactatgcgatgggggcc
ggtggtttctttaaaggcattgatgcgctgccgctgaccgggcaatacacgcactatgca
ctcgataaaaaaacacaaaaaccaaattatgtgactgattctgctgcatcagcgacggcc
tggtcatctggcgtaaaaacgtataatggtgcgttgggggttgatgtttttggtaaagac
catgttacgttgctggaactggccaaaaaagcaggcaaagcgacgggtaatgtctctacc
gctgaactacaagatgccactcctgctgcgcagtttgcccacgtgaccgggcgtaagtgc
tatggcccggaagaaaccagtgagaaatgcagtaccaatgcattggaaaaagggggccgt
ggctctattactgagcagatgattgaagggcgcgctgatgtcacgcttggcggtggtgca
gcatcattcagccaggtcgctaaagccggtgagtggaaagaccagtcgttgcgtgatcag
gcgttggcccgcggctacgtcattgttgagaaccttgatgacctgaatgcaataaaacac
gctaatcaacagaaacctctattgggcttattctcgccaggtaatatgccagtgcgttgg
caggggccgaaagcctcttatcatggcaatctggataaaccgccagtggtgtgtgaaaac
aatgctgagcggaccagcgacattccaacgttggctgtcatgacagaaaaagccattgac
ctgctgaaaaccaatgagaatggcttcttcttgcaagttgaaggggcgtcgattgataaa
caggatcactccgctaacccatgtggtcagtttggtgaaacggttgatctggatgaagcg
gtacaaaaagcgctggaattcgcccgtgctgatggcaacactttggtgattgtgacggct
gaccatgctcactccagccaaattatcgagcctgaagcgaaggctccgggcctgactcag
gcattaacgaccaaagatggcgcggtcatggcgatcagctacggtaactctgaagacgat
tctcaaggccatactgggtcacaattgcggatagcggcttatggtcctcacgcggctaac
gtcgtaggtttaactgaccaaactgatttgttcttcaccatgcgggatgcgatggcactt
aaataa

DBGET integrated database retrieval system