KEGG   Yersinia pseudotuberculosis 1: BZ23_2189Help
Entry
BZ23_2189         CDS       T03679                                 

Definition
(GenBank) amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
ypc  Yersinia pseudotuberculosis 1
Pathway
ypc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZ23_2189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypc02000]
    BZ23_2189
Transporters [BR:ypc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BZ23_2189
   Histidine transporter
    BZ23_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AJJ69475
UniProt: A0A3G5KXA5
Position
complement(2463965..2464651)
Genome map
AA seq 228 aa AA seqDB search
MLDGYSKLIFEGALVTLELALFSVLLSVVIGLMGAGGKLSSNRLVSGLFECYTTLIRGVP
DLVLMLLIFYGLQITLNSITESLGFVQIDIDPLSAGVITLGFIYGAYFTETFRGAYMAVS
KGQIEAATAFGFTSSQIFRRIMFPAMMRYALPGIGNNWQVILKATALVSILGLNDVVKAT
QLAGKGTYQPFFFALVAGAIYLFFTTLSNGVLWWLERRYSHGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctggatggatattccaaactgatatttgaaggtgcgctggtgacactggagttagca
ttgttctcggtgctgctgtcagtggttatcggcttgatgggggccggtggcaagttatcg
tcaaaccggttggtatcgggcttgtttgagtgctacaccacactgatccgtggcgtacct
gatttggttttgatgctgcttatcttctacggtttgcagattaccctcaatagcattacc
gagtcccttggttttgtacaaattgatattgaccctctctctgccggggttatcaccctt
ggctttatctatggcgcttacttcactgaaacgtttcgtggcgcttatatggcggtctct
aaagggcaaattgaggccgcgacggcctttggttttacctccagccagatctttcgtcgc
attatgttcccagccatgatgcgctatgcgttgccgggcatcggtaataattggcaagtg
atcctgaaagcgacggcgctggtgtcaattttaggcttgaatgacgtggtcaaagccacc
caattggcgggaaaaggcacttatcagccgtttttctttgctttggttgctggtgcgatt
tatctgttctttaccactctctctaacggtgtcttgtggtggctggaaaggcgctattcc
catggggtgaagagggctgagctatga

DBGET integrated database retrieval system