KEGG   Yersinia pestis D106004: YPD4_0437
Entry
YPD4_0437         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypd  Yersinia pestis D106004
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_0437
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_0437
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACY57346
Position
529370..529930
AA seq 186 aa
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDR
KFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQM
EKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVE
DDDGEK
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagatgcgagctcgcaaaaatttatcggtagaaataatgcacctagagtgcaa
attgaatatgacgtcgaaatttatggttcaaataagaaagtagagttgccttttgtaacc
ggcgtgatggctgatctttctggccacagagcaaagcctcttcctgctgttgaagatcgt
aaattccttactttcgatcaggataatttcgatgcccggatgagagcaattaagcctcgc
cttaaattctacgtagataacaccttgagtgaggataacgaactcctggatatcgaactg
gattttgagtcaatggatgacttttcccccggatcgttagcgcggcgtattcctcaaatg
gaaaaactgcttgaggcacgcacccatctggctgaattgatcacctatatggatggtaaa
accagcgcagaagaggtggttaaacaactgcttgaacaacctgattttttacaaaatctt
gcgaccgatgcacagggaactatttcgaagctcagccaggatgatgatgttttagtggaa
gatgacgatggagaaaaatag

DBGET integrated database retrieval system