KEGG   Yersinia pestis D106004: YPD4_0986Help
Entry
YPD4_0986         CDS       T01832                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00010  Glycolysis / Gluconeogenesis
ypd00260  Glycine, serine and threonine metabolism
ypd00680  Methane metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01120  Microbial metabolism in diverse environments
ypd01130  Biosynthesis of antibiotics
ypd01200  Carbon metabolism
ypd01230  Biosynthesis of amino acids
Module
ypd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypd_M00002  Glycolysis, core module involving three-carbon compounds
ypd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD4_0986 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YPD4_0986 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPD4_0986 (gpmA)
Enzymes [BR:ypd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YPD4_0986 (gpmA)
Membrane trafficking [BR:ypd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YPD4_0986 (gpmA)
Exosome [BR:ypd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YPD4_0986 (gpmA)
  Exosomal proteins of melanoma cells
   YPD4_0986 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACY57895
Position
complement(1271588..1272340)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKTWKLNERHYGALQGLNKSETAEKYGDEQVKQWRRGFA
ITPPALEKSDERFPGHDPRYAKLTDAELPTTESLALTIERVIPYWNDVIKPRIASGERVI
IAAHGNSLRALVKYLDDLGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctagttttggtacgacacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgaaaaaggccgttctgaagcaaaggca
gcgggtaagctgttaaaagatgaaggcttcacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggaacattttggatgaattagatcaggcatggctgcca
acagaaaaaacctggaagcttaacgagcgtcactacggcgcactgcaaggcctgaataaa
tctgaaacggctgaaaaatacggcgatgagcaggttaagcaatggcgtcgtggctttgcc
atcacccctccagcactggagaaaagcgatgagcgtttcccaggccatgacccacgttat
gcaaaattgactgatgctgagctgccaaccacagaaagcttggcgctgactattgaacgc
gtgattccctactggaatgacgttatcaaaccacgtattgccagcggtgaacgcgtaatt
attgctgctcacggtaactctttacgtgcattggtaaaatatctggatgatctgggcgaa
gacgaaattcttgagctgaacatcccaactggcgtgccattagtgtatgagtttgatgag
aacttcaagcctatcaaacactactatctgggtaacgctgatgaaatcgccgctaaagct
gcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system