KEGG   Yersinia pestis D106004: YPD4_1061Help
Entry
YPD4_1061         CDS       T01832                                 

Definition
(GenBank) putative pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00350  Tyrosine metabolism
ypd00360  Phenylalanine metabolism
ypd00380  Tryptophan metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    YPD4_1061
   00360 Phenylalanine metabolism
    YPD4_1061
   00380 Tryptophan metabolism
    YPD4_1061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypd04147]
    YPD4_1061
Enzymes [BR:ypd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     YPD4_1061
    4.1.1.105  L-tryptophan decarboxylase
     YPD4_1061
Exosome [BR:ypd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPD4_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACY57970
Position
1355725..1357140
Genome map
AA seq 471 aa AA seqDB search
MTPEEFRRHGYAMIDLIADYRQNIELRGVNPTTAPGEIKSRLSLNAPEKAEPFEHIISDI
EELIMPGLLHWQHPDFFGYFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVATN
WLLKMLGLSVAWSGVIQDSASTATLVALISGRERTSNYALMNKGMQNSDAPLIVYTSSEA
HSGVNKAALLAGFGHNNTRLVPTDEHNAMSPLALKKIIQQDLVKGNRPCIVVATTGTTAA
TAMDPLDAIGDITQRYGLWLHVDSAMAGSAMILPECRHLWCGIEKADSVVINPHKWLGAA
FDCSVYCVQDSEHLIRIMSTNPSFLQSDADGKVRNYRDWGIPLGRRFRALKLWFLIREQG
VEGLQARLRRDIANANWLAEQIKNSDDWKLVAPVVLQTLCIRHEPGGLMGDALDNYTRSW
AEKLNQSGKGYVTPATLGGRWMVRVSIGTLGTERHHVEKLWLLLQSLVKER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgaagagtttcgccgccatggctatgccatgatcgacctgattgctgattac
cgacaaaatatcgaattgcgtggcgttaatcccacgacagcacccggtgagattaaatct
cgtctgtcgttaaatgcacctgaaaaagcagaacctttcgaacacattatttctgacata
gaagagctcatcatgccagggctattgcattggcaacatcctgacttttttggttatttt
ccttctaatgtagagttatcctccgttcttggggattgcttgagtactgggctgggggtg
ataggtctgtcttggcaatccagcccggccctgacagaaattgaagaggtggccaccaat
tggttgctaaaaatgcttggtcttagcgttgcctggagtggcgtgattcaggattccgcc
tcaaccgccacgttagtggcgctgatcagcggccgagagcgaacatctaactatgcatta
atgaataaagggatgcaaaacagtgatgcacctttgattgtctacacttcatcagaagcc
catagcggagtgaataaagccgctctgctcgctgggtttggtcataataatacccgttta
gtgcccaccgatgagcacaatgccatgtcacccttggcattaaaaaagatcattcaacag
gatttggtgaagggaaaccggccttgtatcgttgttgctacgacaggtactaccgctgcg
acagcgatggatccccttgatgcgattggtgatattactcagcgttatggtttatggctg
catgtggattctgctatggctggttcagcgatgattttgccagaatgccgtcatctgtgg
tgcggtatagaaaaggctgattctgtggtgataaatccgcataaatggctgggtgctgct
tttgattgttcggtttattgtgtacaagattcagagcatttgattcgtatcatgagtact
aaccccagtttcttacaatccgatgccgatgggaaagtgagaaattaccgcgattggggg
atccccctgggtcgtcgttttcgtgcgcttaagctatggtttctaatccgtgagcaaggg
gtggaagggctgcaggcgcgtttgcgtcgtgatattgccaatgctaattggttagcagaa
caaattaaaaacagcgatgattggaaactggtcgcacctgtagtgttgcaaaccttgtgt
attcgtcatgaaccgggtgggctgatgggcgacgcgttggataattatacccgcagttgg
gccgagaaactcaatcaatctggtaagggttatgttacaccagccacgcttggtggccgc
tggatggtgcgggtttccatcggcactttgggtacggaacgtcatcacgttgagaagttg
tggttgttgttgcagtctttggttaaggagagataa

DBGET integrated database retrieval system