KEGG   Yersinia pestis D106004: YPD4_1202Help
Entry
YPD4_1202         CDS       T01832                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00260  Glycine, serine and threonine metabolism
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01120  Microbial metabolism in diverse environments
ypd01130  Biosynthesis of antibiotics
ypd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPD4_1202 (ltaA)
Enzymes [BR:ypd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     YPD4_1202 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACY58110
Position
complement(1532122..1533141)
Genome map
AA seq 339 aa AA seqDB search
MLIDLRSDTVTQPCAAMRAAMANAEVGDDVYGDDPTVNALEAKAASLSGKEAALFLPTGT
QANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDNVLAA
IKPDDIHFAPTRLLSLENTHNGKVLPLRYLQQAWALTREKKLALHIDGARVFNAAVALNV
PLNDISQYCDTLTICLSKGLGTPVGSLLCGSAEFIHRARRWRKMTGGGMRQAGILAAAGL
YALQHNVARLKDDHDNAQWLEQQLRDLGIEIAAPGAQTNVLYITQSAESALKLGPWMRER
GVLISAGPLTRLITHLNVSRKDLEKVVALWREFIAEQHS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgatttacgcagtgacacagtaacgcaaccctgtgccgccatgcgcgccgcg
atggcgaatgccgaggtcggtgatgatgtgtatggcgatgacccaaccgtcaatgcgctt
gaagccaaagccgccagtttatccggtaaagaagccgcgctgtttctgccaacaggcact
caggcaaatttggtggcgctattgacccattgtcagcgtggtgaagagtatattgtcggc
caaaaagcccataactatttgtatgaagccgggggtgccgccgttttgggcagtatccaa
ccacaacctattgatgccaacgatgacggcacactaccactggataacgttctggccgcc
atcaaacccgatgacattcactttgcccccacccggctgttaagtttggaaaatactcac
aatggcaaagtcttgcctttgcgttatttacagcaagcctgggcgttgacccgcgaaaaa
aaactggcgttacatattgatggcgcacgtgtttttaatgctgcggtggcgctgaatgtg
ccactgaacgatattagccagtattgcgataccctgacaatttgtctgtcaaaaggatta
gggacgcctgttggttccctgctctgtggcagcgcagaattcattcatcgcgcccggcgc
tggcgaaaaatgaccggtggtggtatgcgtcaggccggtattttagcggcagccgggttg
tatgcgctgcaacataatgtggcgagactcaaagatgatcacgataacgcccagtggttg
gaacagcaattacgtgacttaggcattgagatagccgcccccggcgcgcaaacaaacgtg
ctgtacattacgcaatctgccgaatcagcgttgaaacttggcccctggatgcgtgaacgt
ggtgtgctgatcagtgccgggccgctcacccgcctgattactcaccttaacgtgagccga
aaagatctggaaaaagtcgtcgcgctgtggcgtgaatttattgccgagcaacattcatga

DBGET integrated database retrieval system