KEGG   Yersinia pestis D106004: YPD4_1294Help
Entry
YPD4_1294         CDS       T01832                                 

Definition
(GenBank) putative hydroxymethylglutaryl-coenzyme A synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd00280  Valine, leucine and isoleucine degradation
ypd00650  Butanoate metabolism
ypd00900  Terpenoid backbone biosynthesis
ypd01100  Metabolic pathways
ypd01110  Biosynthesis of secondary metabolites
ypd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YPD4_1294
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPD4_1294
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPD4_1294
Enzymes [BR:ypd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     YPD4_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N CP12
Motif
Other DBs
NCBI-ProteinID: ACY58202
Position
1661733..1662971
Genome map
AA seq 412 aa AA seqDB search
MNSIGIEKISIYPSSLALKLSELAQARGGDNKYIQESLMVIKRSLVPQWEDAVTLAVNSA
KDMLNDQDRSDIGLFIIATESGLDQEKAISTWAHRYLGLPATCRVFELKSACHAGAAALK
MAESWISSGLNRGKKVLLINVDISNNMICHGKMEYSLGAGAIALLISDNPVFAVIETGKS
GIHTHEVTDVIRPLPWKEVAFDVEASLFSYMDGLENAFEEYCHQTPEARESTYFNYNLYH
VPFPGISKEAHKVLLELQGLFGKEALATSFKQKVMPSLYYAQKIGATYCGSIFLSLFSLM
VKAPEIKSGDRIGVYSYGSGSCAEYFSMQVGDQAVEIAQQQGAALDILLTQRKILDVAAY
EQLENARSAQMQGKDYRLDGDNLQDWYTHHYSGSGLLILERIDNHLRRYRYA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtattggtattgaaaaaatcagtatctacccaagtagtttggcgctgaaatta
tctgaattggcacaagcacgtggtggggacaataaatacattcaagaatctttaatggtc
ataaagcgcagtttggtaccacagtgggaagatgcggtcacccttgccgtcaatagtgcc
aaggatatgcttaacgatcaggatcgttcggatatcggtttatttatcattgcaacagaa
tcaggtttagaccaagaaaaggccatcagtacttgggcgcatcgttatttaggattacct
gcgacttgccgtgtttttgaactgaaatctgcctgccatgctggtgctgcggcattaaag
atggctgagtcatggatatcgtccggccttaatcgagggaaaaaggtattactgatcaac
gtggatatcagtaataatatgatttgccacgggaagatggaatatagccttggtgctggg
gccattgctttacttatctcagataatcccgtttttgccgttattgaaacagggaaatcg
ggtattcatactcatgaagtgacggatgttattcgcccacttccctggaaagaggtcgct
ttcgatgtagaagccagccttttctcttatatggatggactcgagaatgctttcgaggaa
tattgtcatcagacaccggaggccagagaaagtacctatttcaattataacttataccat
gtccctttccctggcattagtaaagaagcacataaagtattattagaactacaaggactc
tttggaaaagaggcgctagccacttcatttaagcaaaaagtcatgccatccctgtattac
gcgcaaaaaataggcgcgacctattgtggcagcattttcctttccctattttcacttatg
gtgaaagcaccagagattaaatcaggggatcgaataggggtctactcttatggttcagga
tcctgtgccgagtatttcagcatgcaggtcggggaccaggcagtagagattgcacaacag
caaggtgcagcgttggacatactgcttacccagcggaaaatactggatgtggcggcatac
gagcaactggaaaatgcacgtagcgcacaaatgcaaggtaaagactatcgtttagacggg
gacaacttacaggactggtatacacaccattacagcgggagtgggctccttattcttgag
cgtatcgataaccacttacggcgttatcgctatgcatga

DBGET integrated database retrieval system