KEGG   Yersinia pestis D106004: YPD4_1307
Entry
YPD4_1307         CDS       T01832                                 

Gene name
vgrG1
Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypd  Yersinia pestis D106004
Pathway
ypd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD4_1307 (vgrG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_1307 (vgrG1)
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_1307 (vgrG1)
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 Adhesin_P1_N
Other DBs
NCBI-ProteinID: ACY58215
Position
1677411..1679759
AA seq 782 aa
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATML
MHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKIRRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLA
EVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGMHDSGMESVWDLSSAHQVV
EKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADNYLTAGSEGREPESESGAFY
ARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRITSHARRDRSY
EVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGALRAEKGIFISADGQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASP
ANLQVQISLLQQNLTELKQAVLLLSAPKGIALSSGEHLQLSASENLIATAGKNADVSVGK
NFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQNDLMELLARKAITITSTEDEIKITAKK
KITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAPETTEPTSHFT
FS
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgaataccactctcccgactcttcggtttgaccatagccaccacaaactggtggtccgc
gacagcaccgccgccgttgatgtgctgggctttgaaggccacgaaagcctgagccagccg
ttctgttacgacatccaattcaccagcgccgacaaggcgattgacccggcgaccatgctg
atgcacgacgcgtcactgacattggcggccccgatggccgaagcttttggcgtgacggtt
cagcagacccagcgggtgatccaaggggtggtgaccggatttaaacgcctgtcggcctcg
aaagaggaatgccgctacgaactgagcctgcaaccgcgcctggccttgttgtcgcgcagc
catcagaacgggatatatcaggacatgtcggtgccgcagattgtggaaaaaattcggcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccacgc
cgcgagcaggtaatgcaatacggcgaggatgacctgacctttatccgccgcctgctggcc
gaggtggggatctggtttcgttttaccgccgatcccaaactcaatattgatgtggtggag
ttttacgacgaccagcgcttctatcagcaaggactgacgctacaggcggtgccgccttcg
gggatgcacgacagcgggatggagtcggtctgggacttgtccagtgctcatcaggtggtt
gaaaaatcggtcagtaccggcgattacaactaccgcaccgccactgccgatatgacggcc
ggggcagacatcactcggggtgataccaccacctacggcgaagcttatcattacgccgat
aactacctgaccgcaggcagtgaagggcgcgagccggaaagtgaaagcggggccttttat
gcccgtctgcgccatgaacgttacctcaataatcaggcgcgcttcgccggggtggccaat
gcggcggcactgtcaccgggtcaggaactgaaagtcaccggcaacgacgtgccagcacag
tttggcaaaggggtgatagtcacccgcatcaccagccacgcccgccgcgaccgcagctat
gaagtgcattttgaggccatcccttactccgaagagtattgcttccgcccgatcctcatc
aacaagccaaaaatggccggcaccttgcccgcacgggtcaccagcaccacggtgaacgac
acttacggacacatcgacaaagacggccgctaccgtgtcaatctgatgtttgaccgggac
agttgggagcaaggttacgaaagcctgtgggtccgtcaggcccgcccgtatgcgggtgac
agctacggcctgcacctgccgctgctggccggcaccgaagtggcgattgcatttgaggac
ggcaacccggaccggccgtatatcgcctctgtgctgcacgactcggcgcacggcgaccac
gtcaccatcagcaactacaaacgcaacgtactgcgcactccgtcgaacaacaaactgcgc
ctggaggatgaacggggcaaagagcacatcaagctcagcaccgaatacggcggcaaaagc
cagttgaatctggggcatctggtcgataacgagaaacagcctcggggtgagggttttgag
ctgcgcaccgacagttttggtgccttgcgggcagaaaaagggattttcatcagcgctgac
ggccaggcgaaggcacaggggcaggtgctggagatgcaaccggctatcagcctgttgaaa
agtgcgcaggaacagatggaggccatctccgcggatgcacaaaccgccaccgccagtccg
gccaacctacaggtacaaatcagtctgttgcagcaaaatctcactgaactgaaacaagct
gtcctgttactgagtgcgccaaaggggatcgcgttgagcagtggcgaacatttacaactg
tcggccagcgaaaatctgatagccactgccggtaagaatgcggatgtcagtgtaggtaag
aatttttttatcggtgtgggcaacacgctgagcgtatttgtacgcaagctggggataaag
ttgatagcgaatcagggacgaataacggtacaggcccagaatgatctgatggagttattg
gcgcgtaaagcgatcacgatcaccagcaccgaggatgagataaaaatcaccgccaagaag
aagatcacgctgaatgcgggaggcagttatatcacgctggatgagaaccggatcgagtca
ggaacggcgggggaatatttgaccaaagcagggtattacgggcgacaggaaaaggcaaat
aaaccagaagattttccgagtgttgccccggaaacaacagaacccaccagtcatttcact
ttttcctga

DBGET integrated database retrieval system