KEGG   Yersinia pestis D106004: YPD4_1321
Entry
YPD4_1321         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypd  Yersinia pestis D106004
Pathway
ypd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD4_1321
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_1321
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_1321
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACY58229
Position
1704101..1704682
AA seq 193 aa
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIK
VLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLL
ASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLE
LGNNSLTLRTEKK
NT seq 582 nt   +upstreamnt  +downstreamnt
gtgttaactaccgtttggaaaaataaaacctgtacttcgaaacataaaagctgggccgcc
tggaaaaataaaatctgcatccccgcactggtcttgttgctcagtggctgcgggctgacg
caagccgtgaccgatagcaccgtgtcggccacaaaatcactgttttataagcagataaag
gtgctgcatctggactttaccgcccgtgaagccctgaataccgatgcgcacgaggcgaac
tcgtcatcggagccggtaatggtgcgggtttatcagttacgtgatgataaaaccttcctc
aaaacggtgtatcaacaactggcaagcgacggggaggcggcgcttaaagatgacctgctg
gccagccgcagtgtggtggtgaaaccgggcggggcggtaacactggatatgccgatggaa
aaagagacccagtttgtggcagtggtggcgctgttccgtcatccggatatggccaaagac
cactggcgtctgatactcacgctggacgacctgcatcccgataagccccgtacccttgag
ttgggtaataacagcctgaccctgcggacggagaaaaaataa

DBGET integrated database retrieval system