KEGG   Yersinia pestis D106004: YPD4_1323
Entry
YPD4_1323         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypd  Yersinia pestis D106004
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_1323
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_1323
SSDB
Motif
Pfam: VasL ImpA_N EF-hand_7
Other DBs
NCBI-ProteinID: ACY58231
Position
1705159..1706526
AA seq 455 aa
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQ
TAVDFTLARTHTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWR
TMTLCYGDLAQVYRAERALEQLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGL
AKPRGASEPPESLRFASVPVSEPLVYIISEPAPPPVQVVLPASPPRWKAGHGFAAGLSLM
AVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIAELKKQASDVEWARLAEPVLQ
ASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRAAGAAPLVELK
HYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcaggtaataccgagcgtctgctgaaaaccggtggcgatccgcgcgcactggcggat
ttcaccgcactgcggggtgaattaaataaactggcccacccggcccgcccggatgttgat
tgggtgcgagtcgagcagctttgtttggcgctgtttcgccagaacggcgttgagttacag
actgccgttgattttaccctggcacgaacgcacaccgttgggttggcgggcttatgtgaa
gggctggaactgttggcggggttggtctgccatcaatggcgtgggttatggccaccgcaa
acgcatgcccgggtggcgttactggcctggttgagcgaccggctgcagcaagtgtggcgc
accatgacgctgtgctacggtgacctggcgcaggtgtaccgggcagagcgggcgctggaa
cagttgtgtacgcagttgcaaacgctggagctcaaacatttgtgcaagctggacggggtt
cgtttgatgctgcataacgcggcgcagcggttggaaagtaccgaggccgtgtctggcctt
gcgaaaccacggggtgcctctgaaccgcccgagtcgctgcgatttgcctctgtcccggtc
agtgaaccactggtgtatattatcagcgaaccggccccgccacctgttcaggtggtttta
cctgcctcacctccgcgctggaaggcgggccacggttttgccgcggggttatcgttgatg
gcggtactgatggccggcagtttcgttatctggcagtcggtatcatcggatcccgtgagg
gaaacattgctggccactgccagtcctttgccgataccgctgagtgctaactcaatagct
gaactgaaaaaacaggcttcagatgttgagtgggcacgtctggcggaaccggtgttgcaa
gccagtgcgatgcagttagatcaactaacacagttaccgccgttatgggcgcaggctcgg
ggggatgccttgctatctcaggcgcaacaactgtggccgaccaatcaagaggtcaaacga
ctgaatgcgttgtggcagcaacagcgagcagccggtgctgcgcccttggtagagttgaaa
cactatgcattggcgcaagaccgtttgcggcaactggcagaacgactgaatagtctggat
gagaaaaaacgcggatatatgacggtctccgaactgaaatctgccgtctttgctatccaa
cagccgctggcacaggccgtgccactggaagaactgctgcggcaatatcaggaacaatta
gaatcagggcaaactccatcctcagcactgcgtcaacagattgacagccggtttagtcaa
ttgctgaaccgctatgcgttgctggtcgtacctcctggcgttcagtaa

DBGET integrated database retrieval system