KEGG   Yersinia pestis D106004: YPD4_2569Help
Entry
YPD4_2569         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ypd  Yersinia pestis D106004
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_2569
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_2569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ACY59476
Position
complement(3275038..3276387)
Genome map
AA seq 449 aa AA seqDB search
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLV
LRSGKGVLPDGTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSS
LARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSV
LLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLL
LQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYA
SIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMD
VLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagaactaacaaagtcgtttggagtgaggggctttttcttcgcccacaactttttcaa
cagcaagagcgctatcttgaatattacgcccataagcgagctgcaacgataaccccattc
ttttggggatttgcgcaatatgaaattgatagagaagcactctcgtatggcaaattagta
ttgcgatctgggaagggcgtgttacccgacggtacaccatttgatattcccggccatgct
gaattgcctgaaccgctcactatcaccccagaacatctgggtaagttgatctatctggcg
gtaccactgcgcctggataacagtgatgaaaccatttttgatgagcacgatatgagctca
ttggcacgtttttacgcctatgaagctgcgctcaacgataccaatgccattcggcaaggg
ccgaagccggtacaactgtcaagattacgtctcagattagtctcagaaggtgagatgaca
gaatcatggattgggctgccattaaccaaagtcagagcgattcagcctgatgggagtgtc
ttgctacacaccgaagactatattcctccggtgacgggttatgccgcaagttcattgctg
tctgaatggctaacccatcttaatggtttggttaaaatgcgcgcagagatgttggccaat
cgcttgtcaaacagtgatgggaaagcgagcgccagcgcagaaattgtcgattatttgtta
ctgcaaatttttaataaatatgagccgattctcgatcatttaaggcatattcctgaatta
ccgcctattacgctttatcaggaattggctaagttctcgggggaattatctacctttatc
cggaccaaaacccgccgaccccgcccggcacctggctatgatcatgcgaagctctatgcg
tctattcgtccgttggttgacgaagttcatgaactactgaaccagatcttggtgcgtgct
gggcagatgataccgctggagacgaaaggcaatggcgtttggtctgcctccgtactgcct
aatgaattacgctcgttttcaaatctggtccttgccgttcatgcgcaattaccgatggat
gtgctacagcatcaattttcagtacaaacaaaaatcagcgcacctcagcaattgcatgaa
ctggtgcgatcgcatttgccagggttggaactacagcgtttgccggtaccgcccagacaa
attccgtatagcgcagggtacgtttattttgaattgataaaaaatggccccttctgggac
aaagtttccaatgctggtgccattgccctgcatgtggcgggtgatttccctgccttgaaa
atggagctctgggggattagagattcatga

DBGET integrated database retrieval system