KEGG   Yersinia pestis D106004: YPD4_2571Help
Entry
YPD4_2571         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypd  Yersinia pestis D106004
Pathway
ypd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD4_2571
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_2571
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_2571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ACY59478
Structure
PDB: 

Position
complement(3277204..3277689)
Genome map
AA seq 161 aa AA seqDB search
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAH
YIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagatatgtttatcaaaattgatggtattgaaggtgagtctttggatgccaat
cacaaaaacgaaatccaggtattagcttggaactgggatgttgctcaacactcgaatatg
cacagcggttcaggtggcggttcaggtaaagcctctgtttcagatttttgcttcgcacat
tatatcgataaagctagcccgaacttattgagctattgcttgttgggtaagcacattaaa
aatgttcagttcgtactgcgtaaagctggtggcgatccgctggaatatctgacaattaaa
tttaccgatgtcatcattactcgtgttgatatggcgggttctttggaagatgaaacgcgt
ccacgtgaagaaattcgtttctcattcactaagatgactcaggactatgttatgcagaat
gctgaaggccataagtctggcgttatttctgctaactacgatgttaaagctaacatgcac
agctaa

DBGET integrated database retrieval system