KEGG   Yersinia pestis D106004: YPD4_2581
Entry
YPD4_2581         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ypd  Yersinia pestis D106004
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_2581
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_2581
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACY59488
Position
3290053..3291888
AA seq 611 aa
MREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRL
LDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQD
VELWPLEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPI
YIDGDERIVSHIFELLHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWN
IFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRF
LLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQQAETSNEVVF
NPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDS
LRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRL
IRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGN
GLLVYGRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGH
WKARPGRRGVL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcgcgagatggcgcaagagtttgctgaaaaacatcccaaaatagcaggccgcctgggc
atgcatgggattgaagtcgccgacccttacgttgagcggctgatagagtccttctgtttt
ttatctgccagaacgcagattaagttggatgctgagtttcctaaatttactcagcgtctt
ttggacattgtctatcccaattacaattcgccaaccccctcaatgggcgtgatccaactt
aagccaaatctgaaggaaggagatttgactcaagggtattgtgttcccaggggcagctcg
ttcttcacccatatcgcacctggcgagacaacccgctgcgagttccgcagtggtcaggat
gtggagttgtggccactggaaatagcagaagcgcgtctaagctctgttcccccggatatg
cctaatctggaaaagcaccgcattgcctatcatcggcttaaaggtgccttacgcattaaa
ttaaaattagtgggcgatctcactttctcacaattagaaggccttgatcggctgcctatt
tatattgatggtgatgaacgaatcgtttcacatatcttcgagctactccacgccagccat
gttgctaccatcatacgggcaggccacggagagacagcaaaagacaccgtgatcagtgat
cagccactgtcctttgaagggctaagccccgaccaaagcctactgccgctatcatggaat
atctttcacggacataatctggtgcaggaatactttacctgccgccagcgtttctacttt
tttacgctgacacagctgtcgcaaagtttgcgcgataatcataccggtgaagcggaaatc
atcatcctactggacagattaccgcaggatttggtgagccatgttgccccctctcgcttc
ctgttagcctgcacgccagtgattaatctctttcctaaacgcatggataagatcgaaatt
aaccgtgcactgaacgattttcacgtagtaccagaccgtagccgcccactggattatgag
gttttcgccattaataaagtgtttggtcaacaggcggaaaccagcaacgaggtggtattt
aacccactttatcaaacccgtcactgtgataatggcaactttgggcgttatttctccatc
acccgcaaggccagaacgggcgatagcaacaaaagaaaatatgacacccgcacgccttac
gccagtaccgaggtctttgtctcgttggtcgatcaacaagaggctccttatggcgatagc
ttgcgctacctctctattgaagctcaggtgactaatcgggatcttccgcgcctgatttcc
gccagtggtaattttgaattgaccatgtcggattcagcgcccgttcacggtgcccggttt
gtcttccaacccagcgccccacgcgccccctttgccatggatgaatccgcctggcgtttg
attcgccaattgagcttcaactatctgccactgtcagatatgtcccactcgaatgggggg
gagtcactgcgcaatatgctacgtctgtttgttaacgcttcagaccatgaatcgaataca
caaattgacgcgctggtgggctgtaaaagcgagccggtgatccgccggttacccggcaat
ggcctactggtttatggccggggcatctgctgcactttgaccgtggatgaagaaggattc
tccggtatcagcccttatctatttggcatgatcatggaaaattatgtggcccgccatgcc
gcaataaatgtgtttaccgagaccgagctaaactccatgcaaagaggacgtgtcggtcat
tggaaagcccgccctggcagacgaggagtcctgtaa

DBGET integrated database retrieval system