KEGG   Yersinia pestis D106004: YPD4_3072
Entry
YPD4_3072         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
Organism
ypd  Yersinia pestis D106004
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACY59976
Position
3893115..3893759
AA seq 214 aa
MKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPS
FATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQS
ARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFS
LYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
NT seq 645 nt   +upstreamnt  +downstreamnt
gtgaaaaattcattattccgtaagggattcgaacactacatttcctttgttcgcagtgat
gaatcgaagctggtgcttgctgaagagaatgtctcggtcagcctgacgtgcaccaaccgt
gagttgccgctgtcgttgcgcgttggtgatatcaatcaactcagcacagacagcccttca
ttcgcgacgttccgcaatattacccgtccttccgtgccgttgtatccggtgctggatggg
ggcctgcattggtcattgctctccaatatgtcgttgaactacatgtccttactggataag
gacgcgttgaagcaaattctgcatacctatgatttcccaagcctgcataaccggcaatca
gccagggcatcgcaaaagaaactggacgctatccaacgtattgaaacacaaccgattgac
cggttgtttcgtggcttacctgtcagagggctacaaaccacgctatggctggagcaaggc
gcttttagctctgaaggcgagctttatctcttcagcacggtattagctcgcttcttctca
ctgtatgccagcgtcaatgcgtttcatcttttaaaagtcatcaatcttgataatcaggaa
tgttacgaatggccggtacagacaggtcaacatgcactgatgtaa

DBGET integrated database retrieval system