KEGG   Yersinia pestis D106004: YPD4_3262
Entry
YPD4_3262         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypd  Yersinia pestis D106004
Pathway
ypd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD4_3262
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypd02044]
    YPD4_3262
Secretion system [BR:ypd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD4_3262
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACY60166
Position
4128846..4129364
AA seq 172 aa
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPS
GQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATI
IDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccagcttatatctctatcacagggaaaacgcagggcaatattaccgcaggt
gctttcacagctgaatccgtcggtaatatctatgttcaaggtcatgaagacgaaatgttg
gtacaggagtttgagcacattgtgacggtgcctaccgatcctcaatccggccagccttcc
ggccaacgtgcgcacaaaccattgcgtttcactgttgcgtacaacaaagccgttccattg
ctgtataacgcattagcctctggtgaaatgctgccaacagtggaattgaagtggtaccgc
acctcgattgaaggcaaacaagagcatttcttcacgactaaactggaagatgccaccatt
atcgacattgattgtaaaatgccgcattgtcaggattccaccaaggctgagtttactcaa
ttagtccgtgtatcactggcataccgcaagattaactgggatcacaccaccgcgggcacc
tctggtgctgatgactggcgtgcgccgatcgaagcgtaa

DBGET integrated database retrieval system